Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q3SXZ7 (TTLL9_HUMAN)

Entry version 123 (02 Dec 2020)
Sequence version 3 (25 Nov 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Probable tubulin polyglutamylase TTLL9

Gene

TTLL9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable tubulin polyglutamylase that forms polyglutamate side chains on tubulin. Acts when complexed with other proteins. By mediating tubulin polyglutamylation, plays a role in the establishment of microtubule heterogeneity in sperm flagella.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei224ATPBy similarity1
Binding sitei226ATPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi211 – 214ATP bindingBy similarity4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionLigase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q3SXZ7

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-8955332, Carboxyterminal post-translational modifications of tubulin

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Probable tubulin polyglutamylase TTLL9 (EC:6.-.-.-By similarity)
Alternative name(s):
Tubulin--tyrosine ligase-like protein 9
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TTLL9
Synonyms:C20orf125
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000131044.16

Human Gene Nomenclature Database

More...HGNCi		HGNC:16118, TTLL9

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q3SXZ7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		164395

Open Targets

More...OpenTargetsi		ENSG00000131044

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA25666

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q3SXZ7, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TTLL9

Domain mapping of disease mutations (DMDM)

More...DMDMi		215274204

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003245171 – 439Probable tubulin polyglutamylase TTLL9Add BLAST439

Proteomic databases

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q3SXZ7

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q3SXZ7

PeptideAtlas

More...PeptideAtlasi		Q3SXZ7

PRoteomics IDEntifications database

More...PRIDEi		Q3SXZ7

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		61828 [Q3SXZ7-1]
61829 [Q3SXZ7-2]
61830 [Q3SXZ7-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q3SXZ7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q3SXZ7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000131044, Expressed in right uterine tube and 149 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q3SXZ7, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q3SXZ7, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000131044, Tissue enhanced (brain, epididymis, fallopian tube, testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		127895, 6 interactors

Protein interaction database and analysis system

More...IntActi		Q3SXZ7, 5 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000442515

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q3SXZ7, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini40 – 380TTLPROSITE-ProRule annotationAdd BLAST341

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the tubulin--tyrosine ligase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2157, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000159879

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_010131_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q3SXZ7

Identification of Orthologs from Complete Genome Data

More...OMAi		YVPLKAW

Database of Orthologous Groups

More...OrthoDBi		584228at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q3SXZ7

TreeFam database of animal gene trees

More...TreeFami		TF313087

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.1490.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR013815, ATP_grasp_subdomain_1
IPR004344, TTL/TTLL_fam
IPR027751, TTLL9

The PANTHER Classification System

More...PANTHERi		PTHR12241:SF39, PTHR12241:SF39, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03133, TTL, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51221, TTL, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3SXZ7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVPSREALLG PGTTAIRCPK KLQNQNYKGH GLSKGKEREQ RASIRFKTTL 
        60         70         80         90        100
MNTLMDVLRH RPGWVEVKDE GEWDFYWCDV SWLRENFDHT YMDEHVRISH 
       110        120        130        140        150
FRNHYELTRK NYMVKNLKRF RKQLEREAGK LEAAKCDFFP KTFEMPCEYH 
       160        170        180        190        200
LFVEEFRKNP GITWIMKPVA RSQGKGIFLF RRLKDIVDWR KDTRSSDDQK 
       210        220        230        240        250
DDIPVENYVA QRYIENPYLI GGRKFDLRVY VLVMSVFAEC LLWSGHRRQD 
       260        270        280        290        300
VHLTNVAVQK TSPDYHPKKG CKWTLQRFRQ YLASKHGPEA VETLFRDIDN 
       310        320        330        340        350
IFVKSLQSVQ KVIISDKHCF ELYGYDILID QDLKPWLLEV NASPSLTASS 
       360        370        380        390        400
QEDYELKTCL LEDTLHVVDM EARLTGREKR VGGFDLMWND GPVSREEGAP 
       410        420        430 
DLSGMGNFVT NTHLGCVNDR KKQLRQLFCS LQVQKKASS
Length:439
Mass (Da):51,472
Last modified:November 25, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iED6172FE902F791C
GO
Isoform 2 (identifier: Q3SXZ7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: Missing.
     236-250: VFAECLLWSGHRRQD → YIPLRAWLYRDGFARFSNTRFTLNSIDDQY
     374-439: LTGREKRVGGFDLMWNDGPVSREEGAPDLSGMGNFVTNTHLGCVNDRKKQLRQLFCSLQVQKKASS → SLRADSPCW

Show »
Length:347
Mass (Da):41,501
Checksum:iA39458A3476859A1
GO
Isoform 3 (identifier: Q3SXZ7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: Missing.
     169-191: Missing.
     236-250: VFAECLLWSGHRRQD → YIPLRAWLYRDGFARFSNTRFTLNSIDDQY
     270-439: GCKWTLQRFR...SLQVQKKASS → VAPGGQCVPITDSQQPGRL

Show »
Length:230
Mass (Da):27,588
Checksum:i4622BF551667A4FF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4DZ96B4DZ96_HUMAN
Tubulin--tyrosine ligase-like prote...
TTLL9
279Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X135A0A087X135_HUMAN
Tubulin--tyrosine ligase-like prote...
TTLL9
341Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WXF5A0A087WXF5_HUMAN
Tubulin--tyrosine ligase-like prote...
TTLL9
225Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y6A5A0A2R8Y6A5_HUMAN
Tubulin--tyrosine ligase-like prote...
TTLL9
379Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WWB8A0A087WWB8_HUMAN
Probable tubulin polyglutamylase TT...
TTLL9
184Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MR21A0A0A0MR21_HUMAN
Probable tubulin polyglutamylase TT...
TTLL9
105Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YD21A0A2R8YD21_HUMAN
Probable tubulin polyglutamylase TT...
TTLL9
59Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WYL2A0A087WYL2_HUMAN
Probable tubulin polyglutamylase TT...
TTLL9
39Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence EAW76401 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti274T → M in AAI04026 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03980576Y → C. Corresponds to variant dbSNP:rs17093689Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0357651 – 50Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_035766169 – 191Missing in isoform 3. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_035767236 – 250VFAEC…HRRQD → YIPLRAWLYRDGFARFSNTR FTLNSIDDQY in isoform 2 and isoform 3. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_035768270 – 439GCKWT…KKASS → VAPGGQCVPITDSQQPGRL in isoform 3. 1 PublicationAdd BLAST170
Alternative sequenceiVSP_035769374 – 439LTGRE…KKASS → SLRADSPCW in isoform 2. 1 PublicationAdd BLAST66

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK093491 mRNA Translation: BAG52730.1
AL031658 Genomic DNA No translation available.
AL359765 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW76401.1 Sequence problems.
CH471077 Genomic DNA Translation: EAW76403.1
BC104024 mRNA Translation: AAI04025.1
BC104025 mRNA Translation: AAI04026.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS42863.1 [Q3SXZ7-1]

NCBI Reference Sequences

More...RefSeqi		NP_001008409.1, NM_001008409.2 [Q3SXZ7-1]
XP_006723787.1, XM_006723724.2
XP_011526948.1, XM_011528646.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000375922; ENSP00000495141; ENSG00000131044 [Q3SXZ7-2]
ENST00000375938; ENSP00000365105; ENSG00000131044 [Q3SXZ7-1]
ENST00000535842; ENSP00000442515; ENSG00000131044 [Q3SXZ7-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		164395

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:164395

UCSC genome browser

More...UCSCi		uc002wwy.2, human [Q3SXZ7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK093491 mRNA Translation: BAG52730.1
AL031658 Genomic DNA No translation available.
AL359765 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW76401.1 Sequence problems.
CH471077 Genomic DNA Translation: EAW76403.1
BC104024 mRNA Translation: AAI04025.1
BC104025 mRNA Translation: AAI04026.1
CCDSiCCDS42863.1 [Q3SXZ7-1]
RefSeqiNP_001008409.1, NM_001008409.2 [Q3SXZ7-1]
XP_006723787.1, XM_006723724.2
XP_011526948.1, XM_011528646.1

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi127895, 6 interactors
IntActiQ3SXZ7, 5 interactors
STRINGi9606.ENSP00000442515

PTM databases

iPTMnetiQ3SXZ7
PhosphoSitePlusiQ3SXZ7

Polymorphism and mutation databases

BioMutaiTTLL9
DMDMi215274204

Proteomic databases

MaxQBiQ3SXZ7
PaxDbiQ3SXZ7
PeptideAtlasiQ3SXZ7
PRIDEiQ3SXZ7
ProteomicsDBi61828 [Q3SXZ7-1]
61829 [Q3SXZ7-2]
61830 [Q3SXZ7-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		49885, 40 antibodies

Genome annotation databases

EnsembliENST00000375922; ENSP00000495141; ENSG00000131044 [Q3SXZ7-2]
ENST00000375938; ENSP00000365105; ENSG00000131044 [Q3SXZ7-1]
ENST00000535842; ENSP00000442515; ENSG00000131044 [Q3SXZ7-1]
GeneIDi164395
KEGGihsa:164395
UCSCiuc002wwy.2, human [Q3SXZ7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		164395
DisGeNETi164395
EuPathDBiHostDB:ENSG00000131044.16

GeneCards: human genes, protein and diseases

More...GeneCardsi		TTLL9
HGNCiHGNC:16118, TTLL9
HPAiENSG00000131044, Tissue enhanced (brain, epididymis, fallopian tube, testis)
neXtProtiNX_Q3SXZ7
OpenTargetsiENSG00000131044
PharmGKBiPA25666

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2157, Eukaryota
GeneTreeiENSGT00940000159879
HOGENOMiCLU_010131_0_1_1
InParanoidiQ3SXZ7
OMAiYVPLKAW
OrthoDBi584228at2759
PhylomeDBiQ3SXZ7
TreeFamiTF313087

Enzyme and pathway databases

PathwayCommonsiQ3SXZ7
ReactomeiR-HSA-8955332, Carboxyterminal post-translational modifications of tubulin

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		164395, 4 hits in 822 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TTLL9, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		164395
PharosiQ3SXZ7, Tdark

Protein Ontology

More...PROi		PR:Q3SXZ7
RNActiQ3SXZ7, protein

Gene expression databases

BgeeiENSG00000131044, Expressed in right uterine tube and 149 other tissues
ExpressionAtlasiQ3SXZ7, baseline and differential
GenevisibleiQ3SXZ7, HS

Family and domain databases

Gene3Di3.30.1490.20, 1 hit
InterProiView protein in InterPro
IPR013815, ATP_grasp_subdomain_1
IPR004344, TTL/TTLL_fam
IPR027751, TTLL9
PANTHERiPTHR12241:SF39, PTHR12241:SF39, 1 hit
PfamiView protein in Pfam
PF03133, TTL, 1 hit
PROSITEiView protein in PROSITE
PS51221, TTL, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTTLL9_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3SXZ7
Secondary accession number(s): A6NH06
, A6NIS5, B3KSG8, Q3SXZ8, Q5JYS3, Q5JYS4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: November 25, 2008
Last modified: December 2, 2020
This is version 123 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again