Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 109 (12 Aug 2020)
Sequence version 2 (26 Feb 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Mucin-like protein 3

Gene

MUCL3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May modulate NF-kappaB signaling and play a role in cell growth.1 Publication

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q3MIW9

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Mucin-like protein 3Curated
Alternative name(s):
Diffuse panbronchiolitis critical region protein 11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MUCL3Imported
Synonyms:C6orf37, DPCR11 PublicationImported, PBLT
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000168631.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21666, MUCL3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613928, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q3MIW9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini30 – 448ExtracellularSequence analysisAdd BLAST419
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei449 – 469HelicalSequence analysisAdd BLAST21
Topological domaini470 – 517CytoplasmicSequence analysisAdd BLAST48

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
135656

MalaCards human disease database

More...
MalaCardsi
MUCL3

Open Targets

More...
OpenTargetsi
ENSG00000168631

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
171700, Diffuse panbronchiolitis

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134926573

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q3MIW9, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DPCR1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
172046709

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 29Sequence analysisAdd BLAST29
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000031868630 – 517Mucin-like protein 3Add BLAST488

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi88N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi124N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi338N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q3MIW9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q3MIW9

PeptideAtlas

More...
PeptideAtlasi
Q3MIW9

PRoteomics IDEntifications database

More...
PRIDEi
Q3MIW9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
61797 [Q3MIW9-1]
61798 [Q3MIW9-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q3MIW9, 3 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q3MIW9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q3MIW9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in lung, esophagus, stomach, rectum, skin, cervix, testis, kidney, uterus and small intestine (PubMed:12185533). Expressed in pancreas (at protein level) (PubMed:29242154).2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in fetal heart, kidney and lung.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000168631, Expressed in stomach and 55 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q3MIW9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q3MIW9, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000168631, Group enriched (gallbladder, stomach)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
126433, 1 interactor

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q3MIW9, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi172 – 416Thr-richAdd BLAST245

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000016847

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_040657_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3MIW9

Database of Orthologous Groups

More...
OrthoDBi
840286at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q3MIW9

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026623, MUCL3

The PANTHER Classification System

More...
PANTHERi
PTHR22094, PTHR22094, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3MIW9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQPVHSLCS AFGLQCCLLF LLASWGAGAT TFQEYQKTGE LSTSDHIFPL
60 70 80 90 100
TPGLVYSIPF DHIVLHSGQR PPELPKSTEI HEQKRHCNTT RHSKPTDKPT
110 120 130 140 150
GNSKTIDHKS STDNHEAPPT SEENSSNQGK DPMIRNQRSV DPADSTTTHK
160 170 180 190 200
ESAGKKHITP APKSKINCRK STTGKSTVTR KSDKTGRPLE KSMSTLDKTS
210 220 230 240 250
TSSHKTTTSF HNSGNSQTKQ KSTSFPEKIT AASKTTYKTT GTPEESEKTE
260 270 280 290 300
DSRTTVASDK LLTKTTKNIQ ETISANELTQ SLAEPTEHGG RTANENNTPS
310 320 330 340 350
PAEPTENRER TANENKKTIC TKGKNTPVPE KPTENLGNTT LTTETIKAPV
360 370 380 390 400
KSTENPEKTA AVTKTIKPSV KVTGDKSLTT TSSHLNKTEV THQVPTGSFT
410 420 430 440 450
LITSRTKLSS ITSEATGNES HPYLNKDGSQ KGIHAGQMGE NDSFPAWAIV
460 470 480 490 500
IVVLVAVILL LVFLGLIFLV SYMMRTRRTL TQNTQYNDAE DEGGPNSYPV
510
YLMEQQNLGM GQIPSPR
Length:517
Mass (Da):56,347
Last modified:February 26, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE666F46C167602AF
GO
Isoform 2 (identifier: Q3MIW9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-315: Missing.
     316-316: K → MTQVTEKSTEHPEKTTSTTEKTTRTPEKPTLYSE

Show »
Length:235
Mass (Da):25,701
Checksum:i5C8047CD96CDF033
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PEI6E9PEI6_HUMAN
DPCR1
MUCL3
1,393Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GV46A0A1B0GV46_HUMAN
Mucin-like protein 3
MUCL3
1,460Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JN73A0A0G2JN73_HUMAN
Mucin-like protein 3
MUCL3
517Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140T950A0A140T950_HUMAN
Mucin-like protein 3
MUCL3
507Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JIW6A0A0G2JIW6_HUMAN
Mucin-like protein 3
MUCL3
507Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140TA28A0A140TA28_HUMAN
Mucin-like protein 3
MUCL3
889Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAH56248 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_038857337G → R. Corresponds to variant dbSNP:rs11970154Ensembl.1
Natural variantiVAR_038858419E → K1 PublicationCorresponds to variant dbSNP:rs3132580Ensembl.1
Natural variantiVAR_038859517R → Q. Corresponds to variant dbSNP:rs2240804Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0312681 – 315Missing in isoform 2. 3 PublicationsAdd BLAST315
Alternative sequenceiVSP_031269316K → MTQVTEKSTEHPEKTTSTTE KTTRTPEKPTLYSE in isoform 2. 3 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB064272 mRNA Translation: BAB82383.1
AL833738 mRNA Translation: CAH56248.1 Different initiation.
AL662854 Genomic DNA No translation available.
AL773541 Genomic DNA No translation available.
AB110931 Genomic DNA Translation: BAD13697.1
AB110932 Genomic DNA Translation: BAD13698.1
AB202102 Genomic DNA Translation: BAE78623.1
BC069477 mRNA Translation: AAH69477.1
BC101661 mRNA Translation: AAI01662.1
BC101663 mRNA Translation: AAI01664.1

NCBI Reference Sequences

More...
RefSeqi
NP_543146.2, NM_080870.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000304311; ENSP00000305948; ENSG00000168631 [Q3MIW9-1]
ENST00000546848; ENSP00000448383; ENSG00000232251 [Q3MIW9-1]
ENST00000547331; ENSP00000446847; ENSG00000229284 [Q3MIW9-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
135656

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:135656

UCSC genome browser

More...
UCSCi
uc063mxo.1, human [Q3MIW9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB064272 mRNA Translation: BAB82383.1
AL833738 mRNA Translation: CAH56248.1 Different initiation.
AL662854 Genomic DNA No translation available.
AL773541 Genomic DNA No translation available.
AB110931 Genomic DNA Translation: BAD13697.1
AB110932 Genomic DNA Translation: BAD13698.1
AB202102 Genomic DNA Translation: BAE78623.1
BC069477 mRNA Translation: AAH69477.1
BC101661 mRNA Translation: AAI01662.1
BC101663 mRNA Translation: AAI01664.1
RefSeqiNP_543146.2, NM_080870.3

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi126433, 1 interactor

PTM databases

GlyGeniQ3MIW9, 3 sites
iPTMnetiQ3MIW9
PhosphoSitePlusiQ3MIW9

Polymorphism and mutation databases

BioMutaiDPCR1
DMDMi172046709

Proteomic databases

jPOSTiQ3MIW9
MassIVEiQ3MIW9
PeptideAtlasiQ3MIW9
PRIDEiQ3MIW9
ProteomicsDBi61797 [Q3MIW9-1]
61798 [Q3MIW9-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
2593, 166 antibodies

The DNASU plasmid repository

More...
DNASUi
135656

Genome annotation databases

EnsembliENST00000304311; ENSP00000305948; ENSG00000168631 [Q3MIW9-1]
ENST00000546848; ENSP00000448383; ENSG00000232251 [Q3MIW9-1]
ENST00000547331; ENSP00000446847; ENSG00000229284 [Q3MIW9-1]
GeneIDi135656
KEGGihsa:135656
UCSCiuc063mxo.1, human [Q3MIW9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
135656
DisGeNETi135656
EuPathDBiHostDB:ENSG00000168631.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MUCL3
HGNCiHGNC:21666, MUCL3
HPAiENSG00000168631, Group enriched (gallbladder, stomach)
MalaCardsiMUCL3
MIMi613928, gene
neXtProtiNX_Q3MIW9
OpenTargetsiENSG00000168631
Orphaneti171700, Diffuse panbronchiolitis
PharmGKBiPA134926573

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00390000016847
HOGENOMiCLU_040657_1_0_1
InParanoidiQ3MIW9
OrthoDBi840286at2759
PhylomeDBiQ3MIW9

Enzyme and pathway databases

PathwayCommonsiQ3MIW9

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
135656, 8 hits in 862 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FAM46A, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
135656
PharosiQ3MIW9, Tbio

Protein Ontology

More...
PROi
PR:Q3MIW9
RNActiQ3MIW9, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000168631, Expressed in stomach and 55 other tissues
ExpressionAtlasiQ3MIW9, baseline and differential
GenevisibleiQ3MIW9, HS

Family and domain databases

InterProiView protein in InterPro
IPR026623, MUCL3
PANTHERiPTHR22094, PTHR22094, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMUCL3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3MIW9
Secondary accession number(s): C9IZC0, Q658M7, Q8WYN2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: August 12, 2020
This is version 109 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again