Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 137 (02 Jun 2021)
Sequence version 3 (03 May 2011)
Previous versions | rss
Add a publicationFeedback
Protein

Pleckstrin homology domain-containing family G member 6

Gene

PLEKHG6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Guanine nucleotide exchange factor activating the small GTPase RHOA, which, in turn, induces myosin filament formation. Also activates RHOG. Does not activate RAC1, or to a much lower extent than RHOA and RHOG. Part of a functional unit, involving PLEKHG6, MYH10 and RHOA, at the cleavage furrow to advance furrow ingression during cytokinesis. In epithelial cells, required for the formation of microvilli and membrane ruffles on the apical pole. Along with EZR, required for normal macropinocytosis.

2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q3KR16

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q3KR16

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Pleckstrin homology domain-containing family G member 6
Short name:
PH domain-containing family G member 6
Alternative name(s):
Myosin-interacting guanine nucleotide exchange factor
Short name:
MyoGEF
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PLEKHG6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25562, PLEKHG6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611743, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q3KR16

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000008323.15

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi351N → A: Loss of exchange activity. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
55200

Open Targets

More...
OpenTargetsi
ENSG00000008323

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671165

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q3KR16, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PLEKHG6

Domain mapping of disease mutations (DMDM)

More...
DMDMi
332278231

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003079121 – 790Pleckstrin homology domain-containing family G member 6Add BLAST790

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q3KR16

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q3KR16

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q3KR16

PeptideAtlas

More...
PeptideAtlasi
Q3KR16

PRoteomics IDEntifications database

More...
PRIDEi
Q3KR16

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
61734 [Q3KR16-1]
61735 [Q3KR16-2]
61736 [Q3KR16-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q3KR16

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q3KR16

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highest expression in the placenta. Low levels in small intestine, lung, liver, kidney, thymus and heart.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000008323, Expressed in mucosa of transverse colon and 148 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q3KR16, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q3KR16, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000008323, Tissue enhanced (intestine, placenta)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MYH10.

Interacts with ELMO1 and EZR (in an open conformation).

Interacts with CSPP1.

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
120497, 42 interactors

Protein interaction database and analysis system

More...
IntActi
Q3KR16, 32 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000380185

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q3KR16, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q3KR16

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini161 – 353DHPROSITE-ProRule annotationAdd BLAST193
Domaini409 – 509PHPROSITE-ProRule annotationAdd BLAST101

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni63 – 91DisorderedSequence analysisAdd BLAST29
Regioni529 – 677DisorderedSequence analysisAdd BLAST149
Regioni690 – 730DisorderedSequence analysisAdd BLAST41
Regioni748 – 790DisorderedSequence analysisAdd BLAST43

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi73 – 87Basic and acidic residuesSequence analysisAdd BLAST15
Compositional biasi539 – 559Polar residuesSequence analysisAdd BLAST21
Compositional biasi590 – 606Polar residuesSequence analysisAdd BLAST17
Compositional biasi748 – 766Basic and acidic residuesSequence analysisAdd BLAST19

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3521, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161250

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_021968_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3KR16

Identification of Orthologs from Complete Genome Data

More...
OMAi
REQQDTN

Database of Orthologous Groups

More...
OrthoDBi
556467at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q3KR16

TreeFam database of animal gene trees

More...
TreeFami
TF316755

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00160, RhoGEF, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.900.10, 1 hit
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035899, DBL_dom_sf
IPR000219, DH-domain
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR042918, PLEKHG6

The PANTHER Classification System

More...
PANTHERi
PTHR47671, PTHR47671, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00621, RhoGEF, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00233, PH, 1 hit
SM00325, RhoGEF, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48065, SSF48065, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50010, DH_2, 1 hit
PS50003, PH_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3KR16-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKAFGPPHEG PLQGLVASRI ETYGGRHRAS AQSTAGRLYP RGYPVLDPSR
60 70 80 90 100
RRLQQYVPFA RGSGQARGLS PMRLRDPEPE KRHGGHVGAG LLHSPKLKEL
110 120 130 140 150
TKAHELEVRL HTFSMFGMPR LPPEDRRHWE IGEGGDSGLT IEKSWRELVP
160 170 180 190 200
GHKEMSQELC HQQEALWELL TTELIYVRKL KIMTDLLAAG LLNLQRVGLL
210 220 230 240 250
MEVSAETLFG NVPSLIRTHR SFWDEVLGPT LEETRASGQP LDPIGLQSGF
260 270 280 290 300
LTFGQRFHPY VQYCLRVKQT MAYAREQQET NPLFHAFVQW CEKHKRSGRQ
310 320 330 340 350
MLCDLLIKPH QRITKYPLLL HAVLKRSPEA RAQEALNAMI EAVESFLRHI
360 370 380 390 400
NGQVRQGEEQ ESLAAAAQRI GPYEVLEPPS DEVEKNLRPF STLDLTSPML
410 420 430 440 450
GVASEHTRQL LLEGPVRVKE GREGKLDVYL FLFSDVLLVT KPQRKADKAK
460 470 480 490 500
VIRPPLMLEK LVCQPLRDPN SFLLIHLTEF QCVSSALLVH CPSPTDRAQW
510 520 530 540 550
LEKTQQAQAA LQKLKAEEYV QQKRELLTLY RDQDRESPST RPSTPSLEGS
560 570 580 590 600
QSSAEGRTPE FSTIIPHLVV TEDTDEDAPL VPDDTSDSGY GTLIPGTPTG
610 620 630 640 650
SRSPLSRLRQ RALRRDPRLT FSTLELRDIP LRPHPPDPQA PQRRSAPELP
660 670 680 690 700
EGILKGGSLP QEDPPTWSEE EDGASERGNV VVETLHRARL RGQLPSSPTH
710 720 730 740 750
ADSAGESPWE SSGEEEEEGP LFLKAGHTSL RPMRAEDMLR EIREELASQR
760 770 780 790
IEGAEEPRDS RPRKLTRAQL QRMRGPHIIQ LDTPLSASEV
Length:790
Mass (Da):88,960
Last modified:May 3, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i34A2555DEF431EF4
GO
Isoform 2 (identifier: Q3KR16-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MKAFGPPHEGPLQGLVASRIETYGGRHRASAQSTAGRLYPRGYPVL → MGCRLHAPGEKAAH

Show »
Length:758
Mass (Da):85,486
Checksum:i403CED373E96DA23
GO
Isoform 3 (identifier: Q3KR16-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-470: Missing.
     471-508: SFLLIHLTEF...QWLEKTQQAQ → MCPREGGRAS...GEPKIQHPLK

Show »
Length:320
Mass (Da):35,568
Checksum:i4A0D7A82830B807F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H731F5H731_HUMAN
Pleckstrin homology domain-containi...
PLEKHG6
495Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti384E → G in AAI04752 (PubMed:15489334).Curated1
Sequence conflicti459E → D in BAA91741 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03671035A → T2 PublicationsCorresponds to variant dbSNP:rs740842Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0288561 – 470Missing in isoform 3. 1 PublicationAdd BLAST470
Alternative sequenceiVSP_0288571 – 46MKAFG…GYPVL → MGCRLHAPGEKAAH in isoform 2. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_028858471 – 508SFLLI…TQQAQ → MCPREGGRASTIHQKTEKAF GQLLCQPLGEPKIQHPLK in isoform 3. 1 PublicationAdd BLAST38

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK001527 mRNA Translation: BAA91741.1
AK095373 mRNA Translation: BAC04539.1
AF289613 mRNA Translation: AAL55797.1
BC104751 mRNA Translation: AAI04752.1
BC105961 mRNA Translation: AAI05962.1
BC109095 mRNA Translation: AAI09096.1
AC006057 Genomic DNA No translation available.
CH471116 Genomic DNA Translation: EAW88809.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS8541.1 [Q3KR16-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001138328.1, NM_001144856.1 [Q3KR16-1]
NP_001138329.1, NM_001144857.1
NP_060643.2, NM_018173.3 [Q3KR16-1]
XP_005253761.1, XM_005253704.4

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000011684; ENSP00000011684; ENSG00000008323 [Q3KR16-1]
ENST00000304581; ENSP00000304640; ENSG00000008323 [Q3KR16-3]
ENST00000396988; ENSP00000380185; ENSG00000008323 [Q3KR16-1]
ENST00000449001; ENSP00000393194; ENSG00000008323 [Q3KR16-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55200

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55200

UCSC genome browser

More...
UCSCi
uc001qnr.4, human [Q3KR16-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001527 mRNA Translation: BAA91741.1
AK095373 mRNA Translation: BAC04539.1
AF289613 mRNA Translation: AAL55797.1
BC104751 mRNA Translation: AAI04752.1
BC105961 mRNA Translation: AAI05962.1
BC109095 mRNA Translation: AAI09096.1
AC006057 Genomic DNA No translation available.
CH471116 Genomic DNA Translation: EAW88809.1
CCDSiCCDS8541.1 [Q3KR16-1]
RefSeqiNP_001138328.1, NM_001144856.1 [Q3KR16-1]
NP_001138329.1, NM_001144857.1
NP_060643.2, NM_018173.3 [Q3KR16-1]
XP_005253761.1, XM_005253704.4

3D structure databases

SMRiQ3KR16
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi120497, 42 interactors
IntActiQ3KR16, 32 interactors
STRINGi9606.ENSP00000380185

PTM databases

iPTMnetiQ3KR16
PhosphoSitePlusiQ3KR16

Genetic variation databases

BioMutaiPLEKHG6
DMDMi332278231

Proteomic databases

jPOSTiQ3KR16
MassIVEiQ3KR16
PaxDbiQ3KR16
PeptideAtlasiQ3KR16
PRIDEiQ3KR16
ProteomicsDBi61734 [Q3KR16-1]
61735 [Q3KR16-2]
61736 [Q3KR16-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
49879, 138 antibodies

The DNASU plasmid repository

More...
DNASUi
55200

Genome annotation databases

EnsembliENST00000011684; ENSP00000011684; ENSG00000008323 [Q3KR16-1]
ENST00000304581; ENSP00000304640; ENSG00000008323 [Q3KR16-3]
ENST00000396988; ENSP00000380185; ENSG00000008323 [Q3KR16-1]
ENST00000449001; ENSP00000393194; ENSG00000008323 [Q3KR16-2]
GeneIDi55200
KEGGihsa:55200
UCSCiuc001qnr.4, human [Q3KR16-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55200
DisGeNETi55200

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PLEKHG6
HGNCiHGNC:25562, PLEKHG6
HPAiENSG00000008323, Tissue enhanced (intestine, placenta)
MIMi611743, gene
neXtProtiNX_Q3KR16
OpenTargetsiENSG00000008323
PharmGKBiPA142671165
VEuPathDBiHostDB:ENSG00000008323.15

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3521, Eukaryota
GeneTreeiENSGT00940000161250
HOGENOMiCLU_021968_1_0_1
InParanoidiQ3KR16
OMAiREQQDTN
OrthoDBi556467at2759
PhylomeDBiQ3KR16
TreeFamiTF316755

Enzyme and pathway databases

PathwayCommonsiQ3KR16
SIGNORiQ3KR16

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
55200, 5 hits in 987 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PLEKHG6, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55200
PharosiQ3KR16, Tbio

Protein Ontology

More...
PROi
PR:Q3KR16
RNActiQ3KR16, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000008323, Expressed in mucosa of transverse colon and 148 other tissues
ExpressionAtlasiQ3KR16, baseline and differential
GenevisibleiQ3KR16, HS

Family and domain databases

CDDicd00160, RhoGEF, 1 hit
Gene3Di1.20.900.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR035899, DBL_dom_sf
IPR000219, DH-domain
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
IPR042918, PLEKHG6
PANTHERiPTHR47671, PTHR47671, 1 hit
PfamiView protein in Pfam
PF00621, RhoGEF, 1 hit
SMARTiView protein in SMART
SM00233, PH, 1 hit
SM00325, RhoGEF, 1 hit
SUPFAMiSSF48065, SSF48065, 1 hit
PROSITEiView protein in PROSITE
PS50010, DH_2, 1 hit
PS50003, PH_DOMAIN, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPKHG6_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3KR16
Secondary accession number(s): Q3SWR1
, Q8N1P1, Q8WYY1, Q9H8F4, Q9NVK9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: May 3, 2011
Last modified: June 2, 2021
This is version 137 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again