Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Solute carrier family 25 member 35

Gene

SLC25A35

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Keywordsi

Biological processTransport

Protein family/group databases

TCDBi2.A.29.15.2 the mitochondrial carrier (mc) family

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier family 25 member 35
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000125434.10
HGNCiHGNC:31921 SLC25A35
MIMi610818 gene
neXtProtiNX_Q3KQZ1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei38 – 58Helical; Name=1Sequence analysisAdd BLAST21
Transmembranei59 – 79Helical; Name=2Sequence analysisAdd BLAST21
Transmembranei91 – 119Helical; Name=3Sequence analysisAdd BLAST29
Transmembranei169 – 190Helical; Name=4Sequence analysisAdd BLAST22
Transmembranei205 – 225Helical; Name=5Sequence analysisAdd BLAST21
Transmembranei277 – 300Helical; Name=6Sequence analysisAdd BLAST24

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000125434
PharmGKBiPA142670907

Polymorphism and mutation databases

BioMutaiSLC25A35
DMDMi121942600

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002917941 – 300Solute carrier family 25 member 35Add BLAST300

Proteomic databases

EPDiQ3KQZ1
MaxQBiQ3KQZ1
PaxDbiQ3KQZ1
PeptideAtlasiQ3KQZ1
PRIDEiQ3KQZ1
ProteomicsDBi61730
61731 [Q3KQZ1-2]
61732 [Q3KQZ1-3]
61733 [Q3KQZ1-4]

PTM databases

iPTMnetiQ3KQZ1
PhosphoSitePlusiQ3KQZ1

Expressioni

Gene expression databases

BgeeiENSG00000125434 Expressed in 150 organ(s), highest expression level in right testis
CleanExiHS_SLC25A35
GenevisibleiQ3KQZ1 HS

Organism-specific databases

HPAiHPA051720

Interactioni

Protein-protein interaction databases

BioGridi134361, 6 interactors
IntActiQ3KQZ1, 1 interactor
STRINGi9606.ENSP00000369407

Structurei

3D structure databases

ProteinModelPortaliQ3KQZ1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati1 – 90Solcar 1Add BLAST90
Repeati100 – 193Solcar 2Add BLAST94
Repeati203 – 294Solcar 3Add BLAST92

Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0755 Eukaryota
ENOG410XS37 LUCA
GeneTreeiENSGT00550000074760
HOGENOMiHOG000165141
HOVERGENiHBG108440
InParanoidiQ3KQZ1
KOiK15117
OMAiQFFMNGV
OrthoDBiEOG091G0MCY
PhylomeDBiQ3KQZ1
TreeFamiTF324506

Family and domain databases

Gene3Di1.50.40.10, 1 hit
InterProiView protein in InterPro
IPR040062 Mitochondrial_carrier_protein
IPR018108 Mitochondrial_sb/sol_carrier
IPR023395 Mt_carrier_dom_sf
PANTHERiPTHR24089 PTHR24089, 1 hit
PfamiView protein in Pfam
PF00153 Mito_carr, 3 hits
SUPFAMiSSF103506 SSF103506, 1 hit
PROSITEiView protein in PROSITE
PS50920 SOLCAR, 3 hits

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q3KQZ1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDFLMSGLAA CGACVFTNPL EVVKTRMQLQ GELQAPGTYQ RHYRNVFHAF
60 70 80 90 100
ITIGKVDGLA ALQKGLAPAL LYQFLMNGIR LGTYGLAEAG GYLHTAEGTH
110 120 130 140 150
SPARSAAAGA MAGVMGAYLG SPIYMVKTHL QAQAASEIAV GHQYKHQGMF
160 170 180 190 200
QALTEIGQKH GLVGLWRGAL GGLPRVIVGS STQLCTFSST KDLLSQWEIF
210 220 230 240 250
PPQSWKLALV AAMMSGIAVV LAMAPFDVAC TRLYNQPTDA QGKGLMYRGI
260 270 280 290 300
LDALLQTART EGIFGMYKGI GASYFRLGPH TILSLFFWDQ LRSLYYTDTK
Length:300
Mass (Da):32,438
Last modified:November 8, 2005 - v1
Checksum:i21F86F522C831A4D
GO
Isoform 2 (identifier: Q3KQZ1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     269-300: GIGASYFRLGPHTILSLFFWDQLRSLYYTDTK → EPSPQVLSNIMQCFSAFTGDQRC

Show »
Length:291
Mass (Da):31,229
Checksum:iE75C21EF1FB22EBF
GO
Isoform 3 (identifier: Q3KQZ1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     265-268: Missing.
     269-300: GIGASYFRLGPHTILSLFFWDQLRSLYYTDTK → EPSPQVLSNIMQCFSAFTGDQRC

Show »
Length:287
Mass (Da):30,750
Checksum:iF9657D38C624603A
GO
Isoform 4 (identifier: Q3KQZ1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     244-300: GLMYRGILDA...LRSLYYTDTK → NRVPKFSATS...CSPILLGTQS

Show »
Length:295
Mass (Da):31,267
Checksum:i45838F33B5632720
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti79I → V in AAR92153 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_026237244 – 300GLMYR…YTDTK → NRVPKFSATSCSASAPLLGT KDVRIVKGQTGHQLFKVTQA PGCSPILLGTQS in isoform 4. 2 PublicationsAdd BLAST57
Alternative sequenceiVSP_026238265 – 268Missing in isoform 3. 1 Publication4
Alternative sequenceiVSP_026239269 – 300GIGAS…YTDTK → EPSPQVLSNIMQCFSAFTGD QRC in isoform 2 and isoform 3. 2 PublicationsAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY498866 mRNA Translation: AAR92153.1
AK097536 mRNA Translation: BAC05091.1
BC101329 mRNA Translation: AAI01330.2
BC101330 mRNA Translation: AAI01331.1
BC105995 mRNA Translation: AAI05996.1
CCDSiCCDS11138.1 [Q3KQZ1-4]
CCDS82067.1 [Q3KQZ1-1]
RefSeqiNP_001307799.1, NM_001320870.1 [Q3KQZ1-1]
NP_001307800.1, NM_001320871.1 [Q3KQZ1-4]
NP_001307801.1, NM_001320872.1 [Q3KQZ1-4]
NP_958928.1, NM_201520.2 [Q3KQZ1-4]
XP_011522148.1, XM_011523846.1 [Q3KQZ1-2]
UniGeneiHs.118918

Genome annotation databases

EnsembliENST00000380067; ENSP00000369407; ENSG00000125434 [Q3KQZ1-4]
ENST00000577745; ENSP00000464231; ENSG00000125434 [Q3KQZ1-1]
ENST00000579192; ENSP00000462395; ENSG00000125434 [Q3KQZ1-4]
ENST00000579681; ENSP00000464307; ENSG00000125434 [Q3KQZ1-3]
ENST00000580340; ENSP00000464071; ENSG00000125434 [Q3KQZ1-4]
ENST00000585311; ENSP00000464191; ENSG00000125434 [Q3KQZ1-2]
GeneIDi399512
KEGGihsa:399512
UCSCiuc002gkt.4 human [Q3KQZ1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY498866 mRNA Translation: AAR92153.1
AK097536 mRNA Translation: BAC05091.1
BC101329 mRNA Translation: AAI01330.2
BC101330 mRNA Translation: AAI01331.1
BC105995 mRNA Translation: AAI05996.1
CCDSiCCDS11138.1 [Q3KQZ1-4]
CCDS82067.1 [Q3KQZ1-1]
RefSeqiNP_001307799.1, NM_001320870.1 [Q3KQZ1-1]
NP_001307800.1, NM_001320871.1 [Q3KQZ1-4]
NP_001307801.1, NM_001320872.1 [Q3KQZ1-4]
NP_958928.1, NM_201520.2 [Q3KQZ1-4]
XP_011522148.1, XM_011523846.1 [Q3KQZ1-2]
UniGeneiHs.118918

3D structure databases

ProteinModelPortaliQ3KQZ1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi134361, 6 interactors
IntActiQ3KQZ1, 1 interactor
STRINGi9606.ENSP00000369407

Protein family/group databases

TCDBi2.A.29.15.2 the mitochondrial carrier (mc) family

PTM databases

iPTMnetiQ3KQZ1
PhosphoSitePlusiQ3KQZ1

Polymorphism and mutation databases

BioMutaiSLC25A35
DMDMi121942600

Proteomic databases

EPDiQ3KQZ1
MaxQBiQ3KQZ1
PaxDbiQ3KQZ1
PeptideAtlasiQ3KQZ1
PRIDEiQ3KQZ1
ProteomicsDBi61730
61731 [Q3KQZ1-2]
61732 [Q3KQZ1-3]
61733 [Q3KQZ1-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000380067; ENSP00000369407; ENSG00000125434 [Q3KQZ1-4]
ENST00000577745; ENSP00000464231; ENSG00000125434 [Q3KQZ1-1]
ENST00000579192; ENSP00000462395; ENSG00000125434 [Q3KQZ1-4]
ENST00000579681; ENSP00000464307; ENSG00000125434 [Q3KQZ1-3]
ENST00000580340; ENSP00000464071; ENSG00000125434 [Q3KQZ1-4]
ENST00000585311; ENSP00000464191; ENSG00000125434 [Q3KQZ1-2]
GeneIDi399512
KEGGihsa:399512
UCSCiuc002gkt.4 human [Q3KQZ1-1]

Organism-specific databases

CTDi399512
EuPathDBiHostDB:ENSG00000125434.10
GeneCardsiSLC25A35
HGNCiHGNC:31921 SLC25A35
HPAiHPA051720
MIMi610818 gene
neXtProtiNX_Q3KQZ1
OpenTargetsiENSG00000125434
PharmGKBiPA142670907
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0755 Eukaryota
ENOG410XS37 LUCA
GeneTreeiENSGT00550000074760
HOGENOMiHOG000165141
HOVERGENiHBG108440
InParanoidiQ3KQZ1
KOiK15117
OMAiQFFMNGV
OrthoDBiEOG091G0MCY
PhylomeDBiQ3KQZ1
TreeFamiTF324506

Miscellaneous databases

ChiTaRSiSLC25A35 human
GenomeRNAii399512
PROiPR:Q3KQZ1
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000125434 Expressed in 150 organ(s), highest expression level in right testis
CleanExiHS_SLC25A35
GenevisibleiQ3KQZ1 HS

Family and domain databases

Gene3Di1.50.40.10, 1 hit
InterProiView protein in InterPro
IPR040062 Mitochondrial_carrier_protein
IPR018108 Mitochondrial_sb/sol_carrier
IPR023395 Mt_carrier_dom_sf
PANTHERiPTHR24089 PTHR24089, 1 hit
PfamiView protein in Pfam
PF00153 Mito_carr, 3 hits
SUPFAMiSSF103506 SSF103506, 1 hit
PROSITEiView protein in PROSITE
PS50920 SOLCAR, 3 hits
ProtoNetiSearch...

Entry informationi

Entry nameiS2535_HUMAN
AccessioniPrimary (citable) accession number: Q3KQZ1
Secondary accession number(s): Q494X5, Q6RGS3, Q8N7Y5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 26, 2007
Last sequence update: November 8, 2005
Last modified: November 7, 2018
This is version 100 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again