Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q3KQZ1 (S2535_HUMAN)

Entry version 116 (10 Feb 2021)
Sequence version 1 (08 Nov 2005)
Previous versions | rss
Add a publicationFeedback
Protein

Solute carrier family 25 member 35

Gene

SLC25A35

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTransport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q3KQZ1

Protein family/group databases

Transport Classification Database

More...TCDBi		2.A.29.15.2, the mitochondrial carrier (mc) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Solute carrier family 25 member 35
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC25A35
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:31921, SLC25A35

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		610818, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q3KQZ1

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000125434.10

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei38 – 58Helical; Name=1Sequence analysisAdd BLAST21
Transmembranei59 – 79Helical; Name=2Sequence analysisAdd BLAST21
Transmembranei91 – 119Helical; Name=3Sequence analysisAdd BLAST29
Transmembranei169 – 190Helical; Name=4Sequence analysisAdd BLAST22
Transmembranei205 – 225Helical; Name=5Sequence analysisAdd BLAST21
Transmembranei277 – 300Helical; Name=6Sequence analysisAdd BLAST24

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		399512

Open Targets

More...OpenTargetsi		ENSG00000125434

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA142670907

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q3KQZ1, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SLC25A35

Domain mapping of disease mutations (DMDM)

More...DMDMi		121942600

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002917941 – 300Solute carrier family 25 member 35Add BLAST300

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q3KQZ1

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q3KQZ1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q3KQZ1

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q3KQZ1

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q3KQZ1

PeptideAtlas

More...PeptideAtlasi		Q3KQZ1

PRoteomics IDEntifications database

More...PRIDEi		Q3KQZ1

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		61730 [Q3KQZ1-1]
61731 [Q3KQZ1-2]
61732 [Q3KQZ1-3]
61733 [Q3KQZ1-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q3KQZ1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q3KQZ1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000125434, Expressed in right testis and 165 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q3KQZ1, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000125434, Tissue enhanced (placenta)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		134361, 9 interactors

Protein interaction database and analysis system

More...IntActi		Q3KQZ1, 5 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000369407

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q3KQZ1, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q3KQZ1

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati1 – 90Solcar 1Add BLAST90
Repeati100 – 193Solcar 2Add BLAST94
Repeati203 – 294Solcar 3Add BLAST92

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the mitochondrial carrier (TC 2.A.29) family. [View classification]Curated

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0755, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000160771

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_015166_14_3_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q3KQZ1

Identification of Orthologs from Complete Genome Data

More...OMAi		VMSRMYN

Database of Orthologous Groups

More...OrthoDBi		1013743at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q3KQZ1

TreeFam database of animal gene trees

More...TreeFami		TF324506

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.50.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR018108, Mitochondrial_sb/sol_carrier
IPR023395, Mt_carrier_dom_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00153, Mito_carr, 3 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF103506, SSF103506, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50920, SOLCAR, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q3KQZ1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDFLMSGLAA CGACVFTNPL EVVKTRMQLQ GELQAPGTYQ RHYRNVFHAF 
        60         70         80         90        100
ITIGKVDGLA ALQKGLAPAL LYQFLMNGIR LGTYGLAEAG GYLHTAEGTH 
       110        120        130        140        150
SPARSAAAGA MAGVMGAYLG SPIYMVKTHL QAQAASEIAV GHQYKHQGMF 
       160        170        180        190        200
QALTEIGQKH GLVGLWRGAL GGLPRVIVGS STQLCTFSST KDLLSQWEIF 
       210        220        230        240        250
PPQSWKLALV AAMMSGIAVV LAMAPFDVAC TRLYNQPTDA QGKGLMYRGI 
       260        270        280        290        300
LDALLQTART EGIFGMYKGI GASYFRLGPH TILSLFFWDQ LRSLYYTDTK
Length:300
Mass (Da):32,438
Last modified:November 8, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i21F86F522C831A4D
GO
Isoform 2 (identifier: Q3KQZ1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     269-300: GIGASYFRLGPHTILSLFFWDQLRSLYYTDTK → EPSPQVLSNIMQCFSAFTGDQRC

Show »
Length:291
Mass (Da):31,229
Checksum:iE75C21EF1FB22EBF
GO
Isoform 3 (identifier: Q3KQZ1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     265-268: Missing.
     269-300: GIGASYFRLGPHTILSLFFWDQLRSLYYTDTK → EPSPQVLSNIMQCFSAFTGDQRC

Show »
Length:287
Mass (Da):30,750
Checksum:iF9657D38C624603A
GO
Isoform 4 (identifier: Q3KQZ1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     244-300: GLMYRGILDA...LRSLYYTDTK → NRVPKFSATS...CSPILLGTQS

Show »
Length:295
Mass (Da):31,267
Checksum:i45838F33B5632720
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti79I → V in AAR92153 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_026237244 – 300GLMYR…YTDTK → NRVPKFSATSCSASAPLLGT KDVRIVKGQTGHQLFKVTQA PGCSPILLGTQS in isoform 4. 2 PublicationsAdd BLAST57
Alternative sequenceiVSP_026238265 – 268Missing in isoform 3. 1 Publication4
Alternative sequenceiVSP_026239269 – 300GIGAS…YTDTK → EPSPQVLSNIMQCFSAFTGD QRC in isoform 2 and isoform 3. 2 PublicationsAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY498866 mRNA Translation: AAR92153.1
AK097536 mRNA Translation: BAC05091.1
BC101329 mRNA Translation: AAI01330.2
BC101330 mRNA Translation: AAI01331.1
BC105995 mRNA Translation: AAI05996.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS11138.1 [Q3KQZ1-4]
CCDS82067.1 [Q3KQZ1-1]

NCBI Reference Sequences

More...RefSeqi		NP_001307799.1, NM_001320870.1 [Q3KQZ1-1]
NP_001307800.1, NM_001320871.1 [Q3KQZ1-4]
NP_001307801.1, NM_001320872.1 [Q3KQZ1-4]
NP_958928.1, NM_201520.2 [Q3KQZ1-4]
XP_011522148.1, XM_011523846.1 [Q3KQZ1-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000380067; ENSP00000369407; ENSG00000125434 [Q3KQZ1-4]
ENST00000577745; ENSP00000464231; ENSG00000125434 [Q3KQZ1-1]
ENST00000579192; ENSP00000462395; ENSG00000125434 [Q3KQZ1-4]
ENST00000579681; ENSP00000464307; ENSG00000125434 [Q3KQZ1-3]
ENST00000580340; ENSP00000464071; ENSG00000125434 [Q3KQZ1-4]
ENST00000585311; ENSP00000464191; ENSG00000125434 [Q3KQZ1-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		399512

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:399512

UCSC genome browser

More...UCSCi		uc002gkt.4, human [Q3KQZ1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY498866 mRNA Translation: AAR92153.1
AK097536 mRNA Translation: BAC05091.1
BC101329 mRNA Translation: AAI01330.2
BC101330 mRNA Translation: AAI01331.1
BC105995 mRNA Translation: AAI05996.1
CCDSiCCDS11138.1 [Q3KQZ1-4]
CCDS82067.1 [Q3KQZ1-1]
RefSeqiNP_001307799.1, NM_001320870.1 [Q3KQZ1-1]
NP_001307800.1, NM_001320871.1 [Q3KQZ1-4]
NP_001307801.1, NM_001320872.1 [Q3KQZ1-4]
NP_958928.1, NM_201520.2 [Q3KQZ1-4]
XP_011522148.1, XM_011523846.1 [Q3KQZ1-2]

3D structure databases

SMRiQ3KQZ1
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi134361, 9 interactors
IntActiQ3KQZ1, 5 interactors
STRINGi9606.ENSP00000369407

Protein family/group databases

TCDBi2.A.29.15.2, the mitochondrial carrier (mc) family

PTM databases

iPTMnetiQ3KQZ1
PhosphoSitePlusiQ3KQZ1

Genetic variation databases

BioMutaiSLC25A35
DMDMi121942600

Proteomic databases

EPDiQ3KQZ1
jPOSTiQ3KQZ1
MassIVEiQ3KQZ1
MaxQBiQ3KQZ1
PaxDbiQ3KQZ1
PeptideAtlasiQ3KQZ1
PRIDEiQ3KQZ1
ProteomicsDBi61730 [Q3KQZ1-1]
61731 [Q3KQZ1-2]
61732 [Q3KQZ1-3]
61733 [Q3KQZ1-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		24621, 63 antibodies

Genome annotation databases

EnsembliENST00000380067; ENSP00000369407; ENSG00000125434 [Q3KQZ1-4]
ENST00000577745; ENSP00000464231; ENSG00000125434 [Q3KQZ1-1]
ENST00000579192; ENSP00000462395; ENSG00000125434 [Q3KQZ1-4]
ENST00000579681; ENSP00000464307; ENSG00000125434 [Q3KQZ1-3]
ENST00000580340; ENSP00000464071; ENSG00000125434 [Q3KQZ1-4]
ENST00000585311; ENSP00000464191; ENSG00000125434 [Q3KQZ1-2]
GeneIDi399512
KEGGihsa:399512
UCSCiuc002gkt.4, human [Q3KQZ1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		399512
DisGeNETi399512

GeneCards: human genes, protein and diseases

More...GeneCardsi		SLC25A35
HGNCiHGNC:31921, SLC25A35
HPAiENSG00000125434, Tissue enhanced (placenta)
MIMi610818, gene
neXtProtiNX_Q3KQZ1
OpenTargetsiENSG00000125434
PharmGKBiPA142670907
VEuPathDBiHostDB:ENSG00000125434.10

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0755, Eukaryota
GeneTreeiENSGT00940000160771
HOGENOMiCLU_015166_14_3_1
InParanoidiQ3KQZ1
OMAiVMSRMYN
OrthoDBi1013743at2759
PhylomeDBiQ3KQZ1
TreeFamiTF324506

Enzyme and pathway databases

PathwayCommonsiQ3KQZ1

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		399512, 4 hits in 877 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SLC25A35, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		399512
PharosiQ3KQZ1, Tdark

Protein Ontology

More...PROi		PR:Q3KQZ1
RNActiQ3KQZ1, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000125434, Expressed in right testis and 165 other tissues
GenevisibleiQ3KQZ1, HS

Family and domain databases

Gene3Di1.50.40.10, 1 hit
InterProiView protein in InterPro
IPR018108, Mitochondrial_sb/sol_carrier
IPR023395, Mt_carrier_dom_sf
PfamiView protein in Pfam
PF00153, Mito_carr, 3 hits
SUPFAMiSSF103506, SSF103506, 1 hit
PROSITEiView protein in PROSITE
PS50920, SOLCAR, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiS2535_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3KQZ1
Secondary accession number(s): Q494X5, Q6RGS3, Q8N7Y5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 26, 2007
Last sequence update: November 8, 2005
Last modified: February 10, 2021
This is version 116 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again