Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 118 (16 Oct 2019)
Sequence version 3 (03 Oct 2012)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ankyrin repeat domain-containing protein 55

Gene

ANKRD55

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ankyrin repeat domain-containing protein 55
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ANKRD55
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25681 ANKRD55

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615189 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q3KP44

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
79722

MalaCards human disease database

More...
MalaCardsi
ANKRD55

Open Targets

More...
OpenTargetsi
ENSG00000164512

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
802 NON RARE IN EUROPE: Multiple sclerosis
85410 Oligoarticular juvenile idiopathic arthritis
85408 Rheumatoid factor-negative juvenile idiopathic arthritis

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA145149863

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q3KP44

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ANKRD55

Domain mapping of disease mutations (DMDM)

More...
DMDMi
408360322

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002744101 – 614Ankyrin repeat domain-containing protein 55Add BLAST614

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei475PhosphoserineBy similarity1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q3KP44

PeptideAtlas

More...
PeptideAtlasi
Q3KP44

PRoteomics IDEntifications database

More...
PRIDEi
Q3KP44

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
3767
61712 [Q3KP44-1]
61713 [Q3KP44-2]
61714 [Q3KP44-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q3KP44

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q3KP44

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000164512 Expressed in 111 organ(s), highest expression level in lymph node

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q3KP44 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q3KP44 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA051049

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122837, 13 interactors

Protein interaction database and analysis system

More...
IntActi
Q3KP44, 29 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000342295

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q3KP44

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati26 – 55ANK 1Add BLAST30
Repeati60 – 89ANK 2Add BLAST30
Repeati93 – 125ANK 3Add BLAST33
Repeati126 – 157ANK 4Add BLAST32
Repeati161 – 190ANK 5Add BLAST30
Repeati194 – 223ANK 6Add BLAST30
Repeati230 – 260ANK 7Add BLAST31
Repeati264 – 293ANK 8Add BLAST30
Repeati297 – 326ANK 9Add BLAST30

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0504 Eukaryota
COG0666 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182908

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000285984

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3KP44

Identification of Orthologs from Complete Genome Data

More...
OMAi
GRPGHQE

Database of Orthologous Groups

More...
OrthoDBi
1115202at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q3KP44

TreeFam database of animal gene trees

More...
TreeFami
TF315452

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.20, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12796 Ank_2, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248 ANK, 9 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48403 SSF48403, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3KP44-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMRQATMDFS TPSVFDQQRG DSSEEVDLTM VYQAASNGDV NALTAVIRED
60 70 80 90 100
PSILECCDSE GCTPLMHAVS GRQADTVKLL LKMGANINMQ DAYGRTSLCL
110 120 130 140 150
ATYLGWLEGC VSLLRNGAKH NIPDKNGRLP LHAATAEPDM RLLTVLLQQS
160 170 180 190 200
NISEINHQDN EGMTPLHWAA FHNQPQHTQM LLKKGADPTL VDKDFKTALH
210 220 230 240 250
WAVQSGNRIL CSIILSHHQG PSIINYDDES GKTCVHIAAA AGFSDIIHEL
260 270 280 290 300
ARVPECNLQA LDVDDRTPLH WAAAAGKAEC VQSLLELGMD SNLRDINEST
310 320 330 340 350
PLAYALYCGH TACVKLLSQE SRTEPTRPPP SQSSRPQKKE RRFNVLNQIF
360 370 380 390 400
CKNKKEEQRA HQKDPSRDRY REEDTSEVND IITTFDSIVG TNCQEQPGDQ
410 420 430 440 450
VAMVEFKKKT SDNSKYLLPE KKPLARKGLP PIRTQSLPPI TLGNNFLTAS
460 470 480 490 500
HRATSHAGLS SAPHHMAQRS QKSRSEQDLL NNRTGCQMLL DNPWKSDSNQ
510 520 530 540 550
VFSYKVWTVS SSDKLLDRLL SVRPGHQEVS VPPHLRHLHN PSSGQNFQHL
560 570 580 590 600
SPNRHKIRDL PFTRNNLAPL PDQKFLSGEP LRTNRVLPAI PSQRRHSTAA
610
EESEHSANPT SDEN
Length:614
Mass (Da):68,414
Last modified:October 3, 2012 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1B2BFC5ED5A72960
GO
Isoform 2 (identifier: Q3KP44-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-288: Missing.

Note: No experimental confirmation available.
Show »
Length:326
Mass (Da):36,983
Checksum:i152A2224959EA5D7
GO
Isoform 3 (identifier: Q3KP44-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-288: Missing.
     289-321: MDSNLRDINESTPLAYALYCGHTACVKLLSQES → ML

Note: No experimental confirmation available.
Show »
Length:295
Mass (Da):33,602
Checksum:i57B698E79F5BA6C2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RBD3D6RBD3_HUMAN
Ankyrin repeat domain-containing pr...
ANKRD55
571Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R9N4D6R9N4_HUMAN
Ankyrin repeat domain-containing pr...
ANKRD55
178Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_030283345V → M1 PublicationCorresponds to variant dbSNP:rs321776Ensembl.1
Natural variantiVAR_055516594R → Q. Corresponds to variant dbSNP:rs34879141Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0227401 – 288Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST288
Alternative sequenceiVSP_022741289 – 321MDSNL…LSQES → ML in isoform 3. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK021857 mRNA Translation: BAB13916.1
AK123389 mRNA Translation: BAG53900.1
AC016585 Genomic DNA No translation available.
AC016638 Genomic DNA No translation available.
CH471123 Genomic DNA Translation: EAW54941.1
BC106914 mRNA Translation: AAI06915.1
BC106915 mRNA Translation: AAI06916.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34161.1 [Q3KP44-1]

NCBI Reference Sequences

More...
RefSeqi
NP_078945.2, NM_024669.2 [Q3KP44-1]
XP_016865342.1, XM_017009853.1 [Q3KP44-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000341048; ENSP00000342295; ENSG00000164512 [Q3KP44-1]
ENST00000434982; ENSP00000429421; ENSG00000164512 [Q3KP44-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79722

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79722

UCSC genome browser

More...
UCSCi
uc003jqt.4 human [Q3KP44-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK021857 mRNA Translation: BAB13916.1
AK123389 mRNA Translation: BAG53900.1
AC016585 Genomic DNA No translation available.
AC016638 Genomic DNA No translation available.
CH471123 Genomic DNA Translation: EAW54941.1
BC106914 mRNA Translation: AAI06915.1
BC106915 mRNA Translation: AAI06916.1
CCDSiCCDS34161.1 [Q3KP44-1]
RefSeqiNP_078945.2, NM_024669.2 [Q3KP44-1]
XP_016865342.1, XM_017009853.1 [Q3KP44-1]

3D structure databases

SMRiQ3KP44
ModBaseiSearch...

Protein-protein interaction databases

BioGridi122837, 13 interactors
IntActiQ3KP44, 29 interactors
STRINGi9606.ENSP00000342295

PTM databases

iPTMnetiQ3KP44
PhosphoSitePlusiQ3KP44

Polymorphism and mutation databases

BioMutaiANKRD55
DMDMi408360322

Proteomic databases

PaxDbiQ3KP44
PeptideAtlasiQ3KP44
PRIDEiQ3KP44
ProteomicsDBi3767
61712 [Q3KP44-1]
61713 [Q3KP44-2]
61714 [Q3KP44-3]

Genome annotation databases

EnsembliENST00000341048; ENSP00000342295; ENSG00000164512 [Q3KP44-1]
ENST00000434982; ENSP00000429421; ENSG00000164512 [Q3KP44-2]
GeneIDi79722
KEGGihsa:79722
UCSCiuc003jqt.4 human [Q3KP44-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79722
DisGeNETi79722

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ANKRD55
HGNCiHGNC:25681 ANKRD55
HPAiHPA051049
MalaCardsiANKRD55
MIMi615189 gene
neXtProtiNX_Q3KP44
OpenTargetsiENSG00000164512
Orphaneti802 NON RARE IN EUROPE: Multiple sclerosis
85410 Oligoarticular juvenile idiopathic arthritis
85408 Rheumatoid factor-negative juvenile idiopathic arthritis
PharmGKBiPA145149863

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0504 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00950000182908
HOGENOMiHOG000285984
InParanoidiQ3KP44
OMAiGRPGHQE
OrthoDBi1115202at2759
PhylomeDBiQ3KP44
TreeFamiTF315452

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ANKRD55 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79722
PharosiQ3KP44

Protein Ontology

More...
PROi
PR:Q3KP44

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000164512 Expressed in 111 organ(s), highest expression level in lymph node
ExpressionAtlasiQ3KP44 baseline and differential
GenevisibleiQ3KP44 HS

Family and domain databases

Gene3Di1.25.40.20, 3 hits
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
PfamiView protein in Pfam
PF12796 Ank_2, 3 hits
SMARTiView protein in SMART
SM00248 ANK, 9 hits
SUPFAMiSSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiANR55_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3KP44
Secondary accession number(s): B3KVT8, Q3KP45, Q9HAD3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: October 3, 2012
Last modified: October 16, 2019
This is version 118 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again