Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ankyrin repeat domain-containing protein 55

Gene

ANKRD55

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Ankyrin repeat domain-containing protein 55
Gene namesi
Name:ANKRD55
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000164512.17
HGNCiHGNC:25681 ANKRD55
MIMi615189 gene
neXtProtiNX_Q3KP44

Pathology & Biotechi

Organism-specific databases

DisGeNETi79722
MalaCardsiANKRD55
OpenTargetsiENSG00000164512
Orphaneti802 NON RARE IN EUROPE: Multiple sclerosis
85410 Oligoarticular juvenile idiopathic arthritis
85408 Rheumatoid factor-negative juvenile idiopathic arthritis
PharmGKBiPA145149863

Polymorphism and mutation databases

BioMutaiANKRD55
DMDMi408360322

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002744101 – 614Ankyrin repeat domain-containing protein 55Add BLAST614

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei475PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ3KP44
PeptideAtlasiQ3KP44
PRIDEiQ3KP44
ProteomicsDBi61712
61713 [Q3KP44-2]
61714 [Q3KP44-3]

PTM databases

iPTMnetiQ3KP44
PhosphoSitePlusiQ3KP44

Expressioni

Gene expression databases

BgeeiENSG00000164512 Expressed in 111 organ(s), highest expression level in lymph node
CleanExiHS_ANKRD55
ExpressionAtlasiQ3KP44 baseline and differential
GenevisibleiQ3KP44 HS

Organism-specific databases

HPAiHPA051049

Interactioni

Protein-protein interaction databases

BioGridi122837, 13 interactors
IntActiQ3KP44, 19 interactors
STRINGi9606.ENSP00000342295

Structurei

3D structure databases

ProteinModelPortaliQ3KP44
SMRiQ3KP44
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati26 – 55ANK 1Add BLAST30
Repeati60 – 89ANK 2Add BLAST30
Repeati93 – 125ANK 3Add BLAST33
Repeati126 – 157ANK 4Add BLAST32
Repeati161 – 190ANK 5Add BLAST30
Repeati194 – 223ANK 6Add BLAST30
Repeati230 – 260ANK 7Add BLAST31
Repeati264 – 293ANK 8Add BLAST30
Repeati297 – 326ANK 9Add BLAST30

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiKOG0504 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00920000149165
HOGENOMiHOG000285984
HOVERGENiHBG080859
InParanoidiQ3KP44
OMAiRPQKKEG
OrthoDBiEOG091G03J9
PhylomeDBiQ3KP44
TreeFamiTF315452

Family and domain databases

CDDicd00204 ANK, 3 hits
Gene3Di1.25.40.20, 3 hits
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
PfamiView protein in Pfam
PF12796 Ank_2, 2 hits
SMARTiView protein in SMART
SM00248 ANK, 9 hits
SUPFAMiSSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 3 hits

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3KP44-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMRQATMDFS TPSVFDQQRG DSSEEVDLTM VYQAASNGDV NALTAVIRED
60 70 80 90 100
PSILECCDSE GCTPLMHAVS GRQADTVKLL LKMGANINMQ DAYGRTSLCL
110 120 130 140 150
ATYLGWLEGC VSLLRNGAKH NIPDKNGRLP LHAATAEPDM RLLTVLLQQS
160 170 180 190 200
NISEINHQDN EGMTPLHWAA FHNQPQHTQM LLKKGADPTL VDKDFKTALH
210 220 230 240 250
WAVQSGNRIL CSIILSHHQG PSIINYDDES GKTCVHIAAA AGFSDIIHEL
260 270 280 290 300
ARVPECNLQA LDVDDRTPLH WAAAAGKAEC VQSLLELGMD SNLRDINEST
310 320 330 340 350
PLAYALYCGH TACVKLLSQE SRTEPTRPPP SQSSRPQKKE RRFNVLNQIF
360 370 380 390 400
CKNKKEEQRA HQKDPSRDRY REEDTSEVND IITTFDSIVG TNCQEQPGDQ
410 420 430 440 450
VAMVEFKKKT SDNSKYLLPE KKPLARKGLP PIRTQSLPPI TLGNNFLTAS
460 470 480 490 500
HRATSHAGLS SAPHHMAQRS QKSRSEQDLL NNRTGCQMLL DNPWKSDSNQ
510 520 530 540 550
VFSYKVWTVS SSDKLLDRLL SVRPGHQEVS VPPHLRHLHN PSSGQNFQHL
560 570 580 590 600
SPNRHKIRDL PFTRNNLAPL PDQKFLSGEP LRTNRVLPAI PSQRRHSTAA
610
EESEHSANPT SDEN
Length:614
Mass (Da):68,414
Last modified:October 3, 2012 - v3
Checksum:i1B2BFC5ED5A72960
GO
Isoform 2 (identifier: Q3KP44-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-288: Missing.

Note: No experimental confirmation available.
Show »
Length:326
Mass (Da):36,983
Checksum:i152A2224959EA5D7
GO
Isoform 3 (identifier: Q3KP44-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-288: Missing.
     289-321: MDSNLRDINESTPLAYALYCGHTACVKLLSQES → ML

Note: No experimental confirmation available.
Show »
Length:295
Mass (Da):33,602
Checksum:i57B698E79F5BA6C2
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RBD3D6RBD3_HUMAN
Ankyrin repeat domain-containing pr...
ANKRD55
571Annotation score:
D6R9N4D6R9N4_HUMAN
Ankyrin repeat domain-containing pr...
ANKRD55
178Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_030283345V → M1 PublicationCorresponds to variant dbSNP:rs321776Ensembl.1
Natural variantiVAR_055516594R → Q. Corresponds to variant dbSNP:rs34879141Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0227401 – 288Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST288
Alternative sequenceiVSP_022741289 – 321MDSNL…LSQES → ML in isoform 3. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK021857 mRNA Translation: BAB13916.1
AK123389 mRNA Translation: BAG53900.1
AC016585 Genomic DNA No translation available.
AC016638 Genomic DNA No translation available.
CH471123 Genomic DNA Translation: EAW54941.1
BC106914 mRNA Translation: AAI06915.1
BC106915 mRNA Translation: AAI06916.1
CCDSiCCDS34161.1 [Q3KP44-1]
RefSeqiNP_078945.2, NM_024669.2 [Q3KP44-1]
XP_016865342.1, XM_017009853.1 [Q3KP44-1]
UniGeneiHs.436214

Genome annotation databases

EnsembliENST00000341048; ENSP00000342295; ENSG00000164512 [Q3KP44-1]
ENST00000434982; ENSP00000429421; ENSG00000164512 [Q3KP44-2]
GeneIDi79722
KEGGihsa:79722
UCSCiuc003jqt.4 human [Q3KP44-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK021857 mRNA Translation: BAB13916.1
AK123389 mRNA Translation: BAG53900.1
AC016585 Genomic DNA No translation available.
AC016638 Genomic DNA No translation available.
CH471123 Genomic DNA Translation: EAW54941.1
BC106914 mRNA Translation: AAI06915.1
BC106915 mRNA Translation: AAI06916.1
CCDSiCCDS34161.1 [Q3KP44-1]
RefSeqiNP_078945.2, NM_024669.2 [Q3KP44-1]
XP_016865342.1, XM_017009853.1 [Q3KP44-1]
UniGeneiHs.436214

3D structure databases

ProteinModelPortaliQ3KP44
SMRiQ3KP44
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122837, 13 interactors
IntActiQ3KP44, 19 interactors
STRINGi9606.ENSP00000342295

PTM databases

iPTMnetiQ3KP44
PhosphoSitePlusiQ3KP44

Polymorphism and mutation databases

BioMutaiANKRD55
DMDMi408360322

Proteomic databases

PaxDbiQ3KP44
PeptideAtlasiQ3KP44
PRIDEiQ3KP44
ProteomicsDBi61712
61713 [Q3KP44-2]
61714 [Q3KP44-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341048; ENSP00000342295; ENSG00000164512 [Q3KP44-1]
ENST00000434982; ENSP00000429421; ENSG00000164512 [Q3KP44-2]
GeneIDi79722
KEGGihsa:79722
UCSCiuc003jqt.4 human [Q3KP44-1]

Organism-specific databases

CTDi79722
DisGeNETi79722
EuPathDBiHostDB:ENSG00000164512.17
GeneCardsiANKRD55
HGNCiHGNC:25681 ANKRD55
HPAiHPA051049
MalaCardsiANKRD55
MIMi615189 gene
neXtProtiNX_Q3KP44
OpenTargetsiENSG00000164512
Orphaneti802 NON RARE IN EUROPE: Multiple sclerosis
85410 Oligoarticular juvenile idiopathic arthritis
85408 Rheumatoid factor-negative juvenile idiopathic arthritis
PharmGKBiPA145149863
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0504 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00920000149165
HOGENOMiHOG000285984
HOVERGENiHBG080859
InParanoidiQ3KP44
OMAiRPQKKEG
OrthoDBiEOG091G03J9
PhylomeDBiQ3KP44
TreeFamiTF315452

Miscellaneous databases

GenomeRNAii79722
PROiPR:Q3KP44
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000164512 Expressed in 111 organ(s), highest expression level in lymph node
CleanExiHS_ANKRD55
ExpressionAtlasiQ3KP44 baseline and differential
GenevisibleiQ3KP44 HS

Family and domain databases

CDDicd00204 ANK, 3 hits
Gene3Di1.25.40.20, 3 hits
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
PfamiView protein in Pfam
PF12796 Ank_2, 2 hits
SMARTiView protein in SMART
SM00248 ANK, 9 hits
SUPFAMiSSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 3 hits
ProtoNetiSearch...

Entry informationi

Entry nameiANR55_HUMAN
AccessioniPrimary (citable) accession number: Q3KP44
Secondary accession number(s): B3KVT8, Q3KP45, Q9HAD3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: October 3, 2012
Last modified: November 7, 2018
This is version 110 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again