Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 102 (17 Jun 2020)
Sequence version 2 (20 Jan 2016)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Membrane-anchored junction protein

Gene

MAJIN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Meiosis-specific telomere-associated protein involved in meiotic telomere attachment to the nucleus inner membrane, a crucial step for homologous pairing and synapsis. Component of the MAJIN-TERB1-TERB2 complex, which promotes telomere cap exchange by mediating attachment of telomeric DNA to the inner nuclear membrane and replacement of the protective cap of telomeric chromosomes: in early meiosis, the MAJIN-TERB1-TERB2 complex associates with telomeric DNA and the shelterin/telosome complex. During prophase, the complex matures and promotes release of the shelterin/telosome complex from telomeric DNA. In the complex, MAJIN acts as the anchoring subunit to the nucleus inner membrane. MAJIN shows DNA-binding activity, possibly for the stabilization of telomere attachment on the nucleus inner membrane.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processMeiosis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Membrane-anchored junction proteinBy similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MAJINImported
Synonyms:C11orf85Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000168070.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:27441 MAJIN

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617130 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q3KP22

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 151NuclearCuratedAdd BLAST151
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei152 – 170HelicalSequence analysisAdd BLAST19
Topological domaini171 – 176Perinuclear spaceCurated6

Keywords - Cellular componenti

Chromosome, Membrane, Nucleus, Telomere

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000168070

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162377786

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q3KP22 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MAJIN

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003258321 – 176Membrane-anchored junction proteinAdd BLAST176

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q3KP22

PeptideAtlas

More...
PeptideAtlasi
Q3KP22

PRoteomics IDEntifications database

More...
PRIDEi
Q3KP22

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
22695
3627
61710 [Q3KP22-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q3KP22

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q3KP22

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000168070 Expressed in right testis and 72 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q3KP22 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q3KP22 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000168070 Tissue enriched (testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the MAJIN-TERB1-TERB2 complex, composed of MAJIN, TERB1 and TERB2.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
129469, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q3KP22, 8 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000301896

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q3KP22 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1176
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q3KP22

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MAJIN family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IJYJ Eukaryota
ENOG410XTYT LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000007971

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_094252_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3KP22

Identification of Orthologs from Complete Genome Data

More...
OMAi
HLKFKHE

Database of Orthologous Groups

More...
OrthoDBi
1129208at2759

TreeFam database of animal gene trees

More...
TreeFami
TF336863

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027816 MAJIN

The PANTHER Classification System

More...
PANTHERi
PTHR35824 PTHR35824, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15077 MAJIN, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: Q3KP22-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSLKPFTYPF PETRFLHAGP NVYKFKIRYG KSIRGEEIEN KEVITQELEV
60 70 80 90 100
PVEKKAVGAV MRKRKHMDEP SSPSRPGLDR AKIGTSSQGP SKKKPPVETR
110 120 130 140 150
RNRERKTQQG LQETLASDIT DVQKQDSEWG HSLPGRIVPP LQHNSPPPKE
160 170
RAATGFFGFL SSLFPFRYFF RKSSHS
Length:176
Mass (Da):20,078
Last modified:January 20, 2016 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEE818AC3BC07B190
GO
Isoform 1 (identifier: Q3KP22-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-49: E → EDSVRVVLGN...KPISDSPLGL
     81-138: AKIGTSSQGP...WGHSLPGRIV → IGKEKPNKDC...SEQPPASLGF
     139-176: Missing.

Show »
Length:216
Mass (Da):24,809
Checksum:i293D4D14024BED42
GO
Isoform 2 (identifier: Q3KP22-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MSLKPFTYPFPETRFLHAGPNVYKFKIRYGKSIRGEEIENKEVITQELE → MKWFHENLSPGKPISDSPLGL

Show »
Length:148
Mass (Da):16,599
Checksum:i5EAA2F438C4FC312
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PRZ4E9PRZ4_HUMAN
Membrane-anchored junction protein
MAJIN
114Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YEC1H0YEC1_HUMAN
Membrane-anchored junction protein
MAJIN
59Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0580601 – 49MSLKP…TQELE → MKWFHENLSPGKPISDSPLG L in isoform 2. Add BLAST49
Alternative sequenceiVSP_05806149E → EDSVRVVLGNLDNLQPFATE HFIVFPYKSKWERVSHLKFK HGEIILIPYPFVFTLYVEMK WFHENLSPGKPISDSPLGL in isoform 1. 1
Alternative sequenceiVSP_05806281 – 138AKIGT…PGRIV → IGKEKPNKDCRRLWPLISLM SRNKILSGDTACQGELSHPC STTHLHLRSEQPPASLGF in isoform 1. Add BLAST58
Alternative sequenceiVSP_058063139 – 176Missing in isoform 1. Add BLAST38

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK093130 mRNA Translation: BAG52661.1
AP000436 Genomic DNA No translation available.
AP001187 Genomic DNA No translation available.
BC106951 mRNA Translation: AAI06952.1
BC106952 mRNA Translation: AAI06953.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31603.1 [Q3KP22-3]
CCDS73316.1 [Q3KP22-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001032302.1, NM_001037225.2 [Q3KP22-3]
NP_001287732.1, NM_001300803.1 [Q3KP22-1]
NP_001305737.1, NM_001318808.1 [Q3KP22-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000301896; ENSP00000301896; ENSG00000168070 [Q3KP22-3]
ENST00000432175; ENSP00000395273; ENSG00000168070 [Q3KP22-3]
ENST00000530444; ENSP00000434568; ENSG00000168070 [Q3KP22-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
283129

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:283129

UCSC genome browser

More...
UCSCi
uc001ocb.2 human [Q3KP22-1]
uc001ocd.2 human

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK093130 mRNA Translation: BAG52661.1
AP000436 Genomic DNA No translation available.
AP001187 Genomic DNA No translation available.
BC106951 mRNA Translation: AAI06952.1
BC106952 mRNA Translation: AAI06953.1
CCDSiCCDS31603.1 [Q3KP22-3]
CCDS73316.1 [Q3KP22-1]
RefSeqiNP_001032302.1, NM_001037225.2 [Q3KP22-3]
NP_001287732.1, NM_001300803.1 [Q3KP22-1]
NP_001305737.1, NM_001318808.1 [Q3KP22-4]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6GNXX-ray2.90A/C1-49[»]
6GNYX-ray1.85A/C1-49[»]
6J08X-ray2.90A/B/C2-49[»]
SMRiQ3KP22
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi129469, 2 interactors
IntActiQ3KP22, 8 interactors
STRINGi9606.ENSP00000301896

PTM databases

iPTMnetiQ3KP22
PhosphoSitePlusiQ3KP22

Polymorphism and mutation databases

BioMutaiMAJIN

Proteomic databases

PaxDbiQ3KP22
PeptideAtlasiQ3KP22
PRIDEiQ3KP22
ProteomicsDBi22695
3627
61710 [Q3KP22-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
52613 39 antibodies

Genome annotation databases

EnsembliENST00000301896; ENSP00000301896; ENSG00000168070 [Q3KP22-3]
ENST00000432175; ENSP00000395273; ENSG00000168070 [Q3KP22-3]
ENST00000530444; ENSP00000434568; ENSG00000168070 [Q3KP22-1]
GeneIDi283129
KEGGihsa:283129
UCSCiuc001ocb.2 human [Q3KP22-1]
uc001ocd.2 human

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
283129
EuPathDBiHostDB:ENSG00000168070.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MAJIN
HGNCiHGNC:27441 MAJIN
HPAiENSG00000168070 Tissue enriched (testis)
MIMi617130 gene
neXtProtiNX_Q3KP22
OpenTargetsiENSG00000168070
PharmGKBiPA162377786

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IJYJ Eukaryota
ENOG410XTYT LUCA
GeneTreeiENSGT00390000007971
HOGENOMiCLU_094252_0_0_1
InParanoidiQ3KP22
OMAiHLKFKHE
OrthoDBi1129208at2759
TreeFamiTF336863

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
283129 9 hits in 782 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MAJIN human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
283129
PharosiQ3KP22 Tdark

Protein Ontology

More...
PROi
PR:Q3KP22
RNActiQ3KP22 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000168070 Expressed in right testis and 72 other tissues
ExpressionAtlasiQ3KP22 baseline and differential
GenevisibleiQ3KP22 HS

Family and domain databases

InterProiView protein in InterPro
IPR027816 MAJIN
PANTHERiPTHR35824 PTHR35824, 2 hits
PfamiView protein in Pfam
PF15077 MAJIN, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMAJIN_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3KP22
Secondary accession number(s): B3KS99, E9PPE5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: January 20, 2016
Last modified: June 17, 2020
This is version 102 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again