Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Membrane-anchored junction protein

Gene

MAJIN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Meiosis-specific telomere-associated protein involved in meiotic telomere attachment to the nucleus inner membrane, a crucial step for homologous pairing and synapsis. Component of the MAJIN-TERB1-TERB2 complex, which promotes telomere cap exchange by mediating attachment of telomeric DNA to the inner nuclear membrane and replacement of the protective cap of telomeric chromosomes: in early meiosis, the MAJIN-TERB1-TERB2 complex associates with telomeric DNA and the shelterin/telosome complex. During prophase, the complex matures and promotes release of the shelterin/telosome complex from telomeric DNA. In the complex, MAJIN acts as the anchoring subunit to the nucleus inner membrane. MAJIN shows DNA-binding activity, possibly for the stabilization of telomere attachment on the nucleus inner membrane.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processMeiosis

Names & Taxonomyi

Protein namesi
Recommended name:
Membrane-anchored junction proteinBy similarity
Gene namesi
Name:MAJINImported
Synonyms:C11orf85Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000168070.11
HGNCiHGNC:27441 MAJIN
MIMi617130 gene
neXtProtiNX_Q3KP22

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 151NuclearCuratedAdd BLAST151
Transmembranei152 – 170HelicalSequence analysisAdd BLAST19
Topological domaini171 – 176Perinuclear spaceCurated6

Keywords - Cellular componenti

Chromosome, Membrane, Nucleus, Telomere

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000168070
PharmGKBiPA162377786

Polymorphism and mutation databases

BioMutaiC11orf85

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003258321 – 176Membrane-anchored junction proteinAdd BLAST176

Proteomic databases

PaxDbiQ3KP22
PeptideAtlasiQ3KP22
PRIDEiQ3KP22
ProteomicsDBi61710

PTM databases

iPTMnetiQ3KP22
PhosphoSitePlusiQ3KP22

Expressioni

Gene expression databases

BgeeiENSG00000168070
CleanExiHS_C11orf85
ExpressionAtlasiQ3KP22 baseline and differential
GenevisibleiQ3KP22 HS

Interactioni

Subunit structurei

Component of the MAJIN-TERB1-TERB2 complex, composed of MAJIN, TERB1 and TERB2.By similarity

Protein-protein interaction databases

BioGridi129469, 2 interactors

Structurei

3D structure databases

ProteinModelPortaliQ3KP22
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the MAJIN family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IJYJ Eukaryota
ENOG410XTYT LUCA
GeneTreeiENSGT00390000007971
HOGENOMiHOG000037935
HOVERGENiHBG101163
InParanoidiQ3KP22
OMAiCSTTHLH
OrthoDBiEOG091G0ITL
TreeFamiTF336863

Family and domain databases

InterProiView protein in InterPro
IPR027816 MAJIN
PANTHERiPTHR35824 PTHR35824, 2 hits
PfamiView protein in Pfam
PF15077 MAJIN, 2 hits

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: Q3KP22-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLKPFTYPF PETRFLHAGP NVYKFKIRYG KSIRGEEIEN KEVITQELEV
60 70 80 90 100
PVEKKAVGAV MRKRKHMDEP SSPSRPGLDR AKIGTSSQGP SKKKPPVETR
110 120 130 140 150
RNRERKTQQG LQETLASDIT DVQKQDSEWG HSLPGRIVPP LQHNSPPPKE
160 170
RAATGFFGFL SSLFPFRYFF RKSSHS
Length:176
Mass (Da):20,078
Last modified:January 20, 2016 - v2
Checksum:iEE818AC3BC07B190
GO
Isoform 1 (identifier: Q3KP22-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-49: E → EDSVRVVLGN...KPISDSPLGL
     81-138: AKIGTSSQGP...WGHSLPGRIV → IGKEKPNKDC...SEQPPASLGF
     139-176: Missing.

Show »
Length:216
Mass (Da):24,809
Checksum:i293D4D14024BED42
GO
Isoform 2 (identifier: Q3KP22-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MSLKPFTYPFPETRFLHAGPNVYKFKIRYGKSIRGEEIENKEVITQELE → MKWFHENLSPGKPISDSPLGL

Show »
Length:148
Mass (Da):16,599
Checksum:i5EAA2F438C4FC312
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0580601 – 49MSLKP…TQELE → MKWFHENLSPGKPISDSPLG L in isoform 2. Add BLAST49
Alternative sequenceiVSP_05806149E → EDSVRVVLGNLDNLQPFATE HFIVFPYKSKWERVSHLKFK HGEIILIPYPFVFTLYVEMK WFHENLSPGKPISDSPLGL in isoform 1. 1
Alternative sequenceiVSP_05806281 – 138AKIGT…PGRIV → IGKEKPNKDCRRLWPLISLM SRNKILSGDTACQGELSHPC STTHLHLRSEQPPASLGF in isoform 1. Add BLAST58
Alternative sequenceiVSP_058063139 – 176Missing in isoform 1. Add BLAST38

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK093130 mRNA Translation: BAG52661.1
AP000436 Genomic DNA No translation available.
AP001187 Genomic DNA No translation available.
BC106951 mRNA Translation: AAI06952.1
BC106952 mRNA Translation: AAI06953.1
CCDSiCCDS31603.1 [Q3KP22-3]
CCDS73316.1 [Q3KP22-1]
RefSeqiNP_001032302.1, NM_001037225.2 [Q3KP22-3]
NP_001287732.1, NM_001300803.1 [Q3KP22-1]
NP_001305737.1, NM_001318808.1 [Q3KP22-4]
UniGeneiHs.567793

Genome annotation databases

EnsembliENST00000301896; ENSP00000301896; ENSG00000168070 [Q3KP22-3]
ENST00000432175; ENSP00000395273; ENSG00000168070 [Q3KP22-3]
ENST00000530444; ENSP00000434568; ENSG00000168070 [Q3KP22-1]
GeneIDi283129
KEGGihsa:283129
UCSCiuc001ocb.2 human [Q3KP22-1]
uc001ocd.2 human

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMAJIN_HUMAN
AccessioniPrimary (citable) accession number: Q3KP22
Secondary accession number(s): B3KS99, E9PPE5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: January 20, 2016
Last modified: June 20, 2018
This is version 87 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health