Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM161A

Gene

FAM161A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in ciliogenesis.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • identical protein binding Source: UniProtKB
  • microtubule binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCilium biogenesis/degradation, Sensory transduction, Vision

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein FAM161A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FAM161A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000170264.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25808 FAM161A

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613596 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q3B820

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Retinitis pigmentosa 28 (RP28)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.
See also OMIM:606068

Keywords - Diseasei

Ciliopathy, Retinitis pigmentosa

Organism-specific databases

DisGeNET

More...
DisGeNETi
84140

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
FAM161A

MalaCards human disease database

More...
MalaCardsi
FAM161A
MIMi606068 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000170264

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
791 Retinitis pigmentosa

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162386876

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FAM161A

Domain mapping of disease mutations (DMDM)

More...
DMDMi
182705173

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003290521 – 660Protein FAM161AAdd BLAST660

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki468Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki484Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q3B820

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q3B820

PeptideAtlas

More...
PeptideAtlasi
Q3B820

PRoteomics IDEntifications database

More...
PRIDEi
Q3B820

ProteomicsDB human proteome resource

More...
ProteomicsDBi
61665
61666 [Q3B820-2]
61667 [Q3B820-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q3B820

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q3B820

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 and isoform 3 are widely expressed with highest levels in retina and testis, with isoform 1 being the most abundant in all tissues tested.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000170264 Expressed in 159 organ(s), highest expression level in pigmented layer of retina

CleanEx database of gene expression profiles

More...
CleanExi
HS_FAM161A

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q3B820 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q3B820 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA032119

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via C-terminus) with microtubules. Interacts with LCA5, CEP290 and SDCCAG8. Interacts with FAM161B. Interacts with POC1B. Interacts with CEP78 (PubMed:27588451).4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
itself3EBI-719941,EBI-719941
BEND3Q5T5X73EBI-719941,EBI-1211496
BEND5Q7L4P63EBI-719941,EBI-724373
CADPSA2RRN75EBI-719941,EBI-10179719
CALCOCO1Q9P1Z23EBI-719941,EBI-749920
CALCOCO2Q131375EBI-719941,EBI-739580
CARD9Q9H2573EBI-719941,EBI-751319
CARD9Q9H257-24EBI-719941,EBI-11530605
CCDC102BQ68D865EBI-719941,EBI-10171570
CCDC136Q96JN2-23EBI-719941,EBI-10171416
CCDC155Q8N6L03EBI-719941,EBI-749265
CCDC57Q2TAC23EBI-719941,EBI-2808286
CCDC57Q2TAC2-24EBI-719941,EBI-10961624
CCNDBP1O952734EBI-719941,EBI-748961
CDR2Q018505EBI-719941,EBI-1181367
CEP44Q9C0F13EBI-719941,EBI-744115
CEP57L1Q8IYX8-23EBI-719941,EBI-10181988
CEP63Q96MT83EBI-719941,EBI-741977
CEP70Q8NHQ15EBI-719941,EBI-739624
DHX32Q7L7V17EBI-719941,EBI-2807297
DOCK8Q8NF50-23EBI-719941,EBI-10174653
EHMT2A2ABF93EBI-719941,EBI-10174566
FAM9BQ8IZU03EBI-719941,EBI-10175124
FSD2A1L4K13EBI-719941,EBI-5661036
GOLGA2Q083794EBI-719941,EBI-618309
HMBOX1Q6NT765EBI-719941,EBI-2549423
IKZF1Q134223EBI-719941,EBI-745305
KIAA0753Q2KHM93EBI-719941,EBI-2805604
KRTAP10-7P604093EBI-719941,EBI-10172290
KRTAP10-9P604113EBI-719941,EBI-10172052
KRTAP5-9P263715EBI-719941,EBI-3958099
LZTS2Q9BRK45EBI-719941,EBI-741037
MCM6Q145663EBI-719941,EBI-374900
MDFIQ997505EBI-719941,EBI-724076
MID2Q9UJV3-25EBI-719941,EBI-10172526
MIPOL1Q8TD105EBI-719941,EBI-2548751
MTUS2Q5JR593EBI-719941,EBI-742948
MTUS2Q5JR59-34EBI-719941,EBI-11522433
NECAB2Q7Z6G3-23EBI-719941,EBI-10172876
NINLQ9Y2I63EBI-719941,EBI-719716
NUTM1Q86Y263EBI-719941,EBI-10178410
PDE4DIPQ5VU433EBI-719941,EBI-1105124
PDE4DIPQ8TBR03EBI-719941,EBI-10240575
PHC2Q8IXK03EBI-719941,EBI-713786
PNMA2Q9UL423EBI-719941,EBI-302355
POC5Q8NA724EBI-719941,EBI-2561090
PPFIA1Q131363EBI-719941,EBI-745426
RINT1Q6NUQ13EBI-719941,EBI-726876
RUNDC3AQ59EK93EBI-719941,EBI-747225
SPERTQ8NA613EBI-719941,EBI-741724
SPERTQ8NA61-24EBI-719941,EBI-11524851
SSX2IPQ9Y2D83EBI-719941,EBI-2212028
STX11O755583EBI-719941,EBI-714135
SYCE1Q8N0S23EBI-719941,EBI-6872807
TFIP11Q9UBB97EBI-719941,EBI-1105213
TMCC2O75069-43EBI-719941,EBI-10177480
TNIP1Q150255EBI-719941,EBI-357849
TRAF1Q130775EBI-719941,EBI-359224
TRIM15Q9C0193EBI-719941,EBI-2342111
TRIM37O949723EBI-719941,EBI-741602
TRIM54Q9BYV25EBI-719941,EBI-2130429
TXLNBQ8N3L33EBI-719941,EBI-6116822
ZBTB1Q9Y2K15EBI-719941,EBI-2682961
ZBTB14O438293EBI-719941,EBI-10176632
ZBTB43O432983EBI-719941,EBI-740718
ZBTB8AQ96BR95EBI-719941,EBI-742740

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123909, 71 interactors

Protein interaction database and analysis system

More...
IntActi
Q3B820, 138 interactors

Molecular INTeraction database

More...
MINTi
Q3B820

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q3B820

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili93 – 120Sequence analysisAdd BLAST28
Coiled coili296 – 320Sequence analysisAdd BLAST25
Coiled coili522 – 552Sequence analysisAdd BLAST31

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi47 – 52Poly-Glu6
Compositional biasi609 – 658Glu-richAdd BLAST50

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FAM161 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157824

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000049209

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG107870

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q3B820

KEGG Orthology (KO)

More...
KOi
K16772

Identification of Orthologs from Complete Genome Data

More...
OMAi
FSNQEMK

Database of Orthologous Groups

More...
OrthoDBi
EOG091G054R

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q3B820

TreeFam database of animal gene trees

More...
TreeFami
TF321199

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019579 UPF0564

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10595 UPF0564, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q3B820-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATSHRVAKL VASSLQTPVN PITGARVAQY EREDPLKALA AAEAILEDEE
60 70 80 90 100
EEKVAQPAGA SADLNTSFSG VDEHAPISYE DFVNFPDIHH SNEEYFKKVE
110 120 130 140 150
ELKAAHIETM AKLEKMYQDK LHLKEVQPVV IREDSLSDSS RSVSEKNSYH
160 170 180 190 200
PVSLMTSFSE PDLGQSSSLY VSSSEEELPN LEKEYPRKNR MMTYAKELIN
210 220 230 240 250
NMWTDFCVED YIRCKDTGFH AAEKRRKKRK EWVPTITVPE PFQMMIREQK
260 270 280 290 300
KKEESMKSKS DIEMVHKALK KQEEDPEYKK KFRANPVPAS VFLPLYHDLV
310 320 330 340 350
KQKEERRRSL KEKSKEALLA SQKPFKFIAR EEQKRAAREK QLRDFLKYKK
360 370 380 390 400
KTNRFKARPI PRSTYGSTTN DKLKEEELYR NLRTQLRAQE HLQNSSPLPC
410 420 430 440 450
RSACGCRNPR CPEQAVKLKC KHKVRCPTPD FEDLPERYQK HLSEHKSPKL
460 470 480 490 500
LTVCKPFDLH ASPHASIKRE KILADIEADE ENLKETRWPY LSPRRKSPVR
510 520 530 540 550
CAGVNPVPCN CNPPVPTVSS RGREQAVRKS EKERMREYQR ELEEREEKLK
560 570 580 590 600
KRPLLFERVA QKNARMAAEK HYSNTLKALG ISDEFVSKKG QSGKVLEYFN
610 620 630 640 650
NQETKSVTED KESFNEEEKI EERENGEENY FIDTNSQDSY KEKDEANEES
660
EEEKSVEESH
Length:660
Mass (Da):76,752
Last modified:April 8, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE2C0D443C1A0DAA5
GO
Isoform 2 (identifier: Q3B820-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-109: Missing.

Note: No experimental confirmation available.
Show »
Length:551
Mass (Da):64,836
Checksum:iF31A08F7C2AB938E
GO
Isoform 3 (identifier: Q3B820-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     527-527: V → VRRSLEEKKMLEEERNRILTKQKQRMKELQKLLTTRAKAYDSHQSLAQISKSRVKCL

Show »
Length:716
Mass (Da):83,492
Checksum:iC2346158DFD127CD
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C4C9H7C4C9_HUMAN
Protein FAM161A
FAM161A
601Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WCZ8F8WCZ8_HUMAN
Protein FAM161A
FAM161A
142Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W731F8W731_HUMAN
Protein FAM161A
FAM161A
75Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAG58969 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti145E → G in BX648834 (PubMed:17974005).Curated1
Sequence conflicti167S → F in BAB14544 (PubMed:14702039).Curated1
Sequence conflicti534R → M in BAG58969 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_060180107I → M1 PublicationCorresponds to variant dbSNP:rs11125895EnsemblClinVar.1
Natural variantiVAR_042630236I → V. Corresponds to variant dbSNP:rs17513722EnsemblClinVar.1
Natural variantiVAR_042631273E → K. Corresponds to variant dbSNP:rs6733774Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0329351 – 109Missing in isoform 2. 1 PublicationAdd BLAST109
Alternative sequenceiVSP_039126527V → VRRSLEEKKMLEEERNRILT KQKQRMKELQKLLTTRAKAY DSHQSLAQISKSRVKCL in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
BX648834 mRNA No translation available.
BX649029 mRNA No translation available.
AC107081 Genomic DNA No translation available.
AK023367 mRNA Translation: BAB14544.1
AK296255 mRNA Translation: BAG58969.1 Different initiation.
BC107162 mRNA No translation available.
BC107163 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS42687.2 [Q3B820-1]
CCDS56120.1 [Q3B820-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001188472.1, NM_001201543.1 [Q3B820-3]
NP_115556.2, NM_032180.2 [Q3B820-1]
XP_016860561.1, XM_017005072.1 [Q3B820-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.440466

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000404929; ENSP00000385158; ENSG00000170264 [Q3B820-3]
ENST00000405894; ENSP00000385893; ENSG00000170264 [Q3B820-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84140

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84140

UCSC genome browser

More...
UCSCi
uc002sbm.5 human [Q3B820-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BX648834 mRNA No translation available.
BX649029 mRNA No translation available.
AC107081 Genomic DNA No translation available.
AK023367 mRNA Translation: BAB14544.1
AK296255 mRNA Translation: BAG58969.1 Different initiation.
BC107162 mRNA No translation available.
BC107163 mRNA No translation available.
CCDSiCCDS42687.2 [Q3B820-1]
CCDS56120.1 [Q3B820-3]
RefSeqiNP_001188472.1, NM_001201543.1 [Q3B820-3]
NP_115556.2, NM_032180.2 [Q3B820-1]
XP_016860561.1, XM_017005072.1 [Q3B820-2]
UniGeneiHs.440466

3D structure databases

ProteinModelPortaliQ3B820
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123909, 71 interactors
IntActiQ3B820, 138 interactors
MINTiQ3B820

PTM databases

iPTMnetiQ3B820
PhosphoSitePlusiQ3B820

Polymorphism and mutation databases

BioMutaiFAM161A
DMDMi182705173

Proteomic databases

EPDiQ3B820
MaxQBiQ3B820
PeptideAtlasiQ3B820
PRIDEiQ3B820
ProteomicsDBi61665
61666 [Q3B820-2]
61667 [Q3B820-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
84140
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000404929; ENSP00000385158; ENSG00000170264 [Q3B820-3]
ENST00000405894; ENSP00000385893; ENSG00000170264 [Q3B820-1]
GeneIDi84140
KEGGihsa:84140
UCSCiuc002sbm.5 human [Q3B820-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84140
DisGeNETi84140
EuPathDBiHostDB:ENSG00000170264.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FAM161A
GeneReviewsiFAM161A

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0002084
HGNCiHGNC:25808 FAM161A
HPAiHPA032119
MalaCardsiFAM161A
MIMi606068 phenotype
613596 gene
neXtProtiNX_Q3B820
OpenTargetsiENSG00000170264
Orphaneti791 Retinitis pigmentosa
PharmGKBiPA162386876

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000157824
HOGENOMiHOG000049209
HOVERGENiHBG107870
InParanoidiQ3B820
KOiK16772
OMAiFSNQEMK
OrthoDBiEOG091G054R
PhylomeDBiQ3B820
TreeFamiTF321199

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FAM161A human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84140

Protein Ontology

More...
PROi
PR:Q3B820

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000170264 Expressed in 159 organ(s), highest expression level in pigmented layer of retina
CleanExiHS_FAM161A
ExpressionAtlasiQ3B820 baseline and differential
GenevisibleiQ3B820 HS

Family and domain databases

InterProiView protein in InterPro
IPR019579 UPF0564
PfamiView protein in Pfam
PF10595 UPF0564, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiF161A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q3B820
Secondary accession number(s): B4DJV7, Q9H8R2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: April 8, 2008
Last modified: December 5, 2018
This is version 109 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again