Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 134 (25 May 2022)
Sequence version 3 (09 Jan 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Vacuolar cation/proton exchanger 1

Gene

CAX1

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Vacuolar cation/proton exchanger (CAX). Translocates Ca2+ and other metal ions into vacuoles using the proton gradient formed by H+-ATPase and H+-pyrophosphatase. Involved in ion homeostasis in association with CAX3. May play a role in cold-acclimation response.

3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Activated by monothiol glutaredoxin GRXS14 and CXIP4. Inhibited by excess of Ca2+ and Cd2+, Na+ and K+, but not Mn2+.4 Publications

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

Measured in vacuolar yeast membrane vesicles with a shorter CAX1 starting at Met-37.
  1. KM=230 µM for Cd2+2 Publications
  2. KM=225 µM for Zn2+2 Publications

pH dependencei

Optimum pH is 7.5 for cytosolic pH.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAntiport, Calcium transport, Ion transport, Transport
LigandCalcium

Enzyme and pathway databases

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
Q39253

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.19.2.3, the ca(2+):cation antiporter (caca) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Vacuolar cation/proton exchanger 1
Alternative name(s):
Ca(2+)/H(+) antiporter CAX1
Ca(2+)/H(+) exchanger 1
Protein CATION EXCHANGER 1
Protein RARE COLD INDUCIBLE 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CAX1
Synonyms:RCI4
Ordered Locus Names:At2g38170
ORF Names:F16M14.10
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT2G38170

The Arabidopsis Information Resource

More...
TAIRi
locus:2042852, AT2G38170

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini2 – 68CytoplasmicSequence analysisAdd BLAST67
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei69 – 89HelicalSequence analysisAdd BLAST21
Topological domaini90 – 96ExtracellularSequence analysis7
Transmembranei97 – 116HelicalSequence analysisAdd BLAST20
Topological domaini117 – 127CytoplasmicSequence analysisAdd BLAST11
Transmembranei128 – 148HelicalSequence analysisAdd BLAST21
Topological domaini149 – 161ExtracellularSequence analysisAdd BLAST13
Transmembranei162 – 182HelicalSequence analysisAdd BLAST21
Topological domaini183 – 197CytoplasmicSequence analysisAdd BLAST15
Transmembranei198 – 218HelicalSequence analysisAdd BLAST21
Topological domaini219 – 238ExtracellularSequence analysisAdd BLAST20
Transmembranei239 – 259HelicalSequence analysisAdd BLAST21
Topological domaini260 – 281CytoplasmicSequence analysisAdd BLAST22
Transmembranei282 – 302HelicalSequence analysisAdd BLAST21
Topological domaini303 – 325ExtracellularSequence analysisAdd BLAST23
Transmembranei326 – 346HelicalSequence analysisAdd BLAST21
Topological domaini347 – 360CytoplasmicSequence analysisAdd BLAST14
Transmembranei361 – 381HelicalSequence analysisAdd BLAST21
Topological domaini382 – 384ExtracellularSequence analysis3
Transmembranei385 – 405HelicalSequence analysisAdd BLAST21
Topological domaini406 – 411CytoplasmicSequence analysis6
Transmembranei412 – 432HelicalSequence analysisAdd BLAST21
Topological domaini433 – 463ExtracellularSequence analysisAdd BLAST31

Keywords - Cellular componenti

Membrane, Vacuole

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the use of a specific protein in the biotechnological industry.<p><a href='/help/biotechnological_use' target='_top'>More...</a></p>Biotechnological usei

CAX1 expression in tomato increases calcium content and prolonges shelf life and may serve as an alternative to the application of CaCl2 used to extend shelf life in numerous agricultural commodities. Expression in potato tubers increases calcium content by 3-fold without the adverse effect of increasing other metal ion contents.2 Publications

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Plants exhibit a 50% reduction in tonoplast Ca2+/H+ exchange activity, a 40% reduction in tonoplast V-type H+-translocating ATPase activity, a 36% increase in tonoplast Ca2+-ATPase activity and an increased expression of CAX3 and CAX4. These plants exhibit altered plant development, perturbed hormone sensitivities, altered auxin signaling response, lower sensitivity to other metal ions and increased freezing tolerance after cold acclimation.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi6T → A: No effect on autoinhibitory regulation. 1 Publication1
Mutagenesisi10S → A: No effect on autoinhibitory regulation. 1 Publication1
Mutagenesisi24S → A: No effect on autoinhibitory regulation. 1 Publication1
Mutagenesisi25S → A: No effect on autoinhibitory regulation. 1 Publication1
Mutagenesisi25S → D: Loss of autoinhibitory regulation. 1 Publication1
Mutagenesisi25S → T: No effect on autoinhibitory regulation. 1 Publication1
Mutagenesisi29R → A: Loss of autoinhibitory regulation; when associated with A-32. 1 Publication1
Mutagenesisi32R → A: Loss of autoinhibitory regulation; when associated with A-29. 1 Publication1
Mutagenesisi33T → A: Loss of autoinhibitory regulation. 1 Publication1
Mutagenesisi33T → D: Loss of autoinhibitory regulation. 1 Publication1
Mutagenesisi33T → E: Loss of autoinhibitory regulation. 1 Publication1
Mutagenesisi33T → S: Loss of autoinhibitory regulation. 1 Publication1
Mutagenesisi259H → A: No effect on transport activity. 1 Publication1
Mutagenesisi338H → A: Loss of transport activity. 1 Publication1
Mutagenesisi338H → K: Reduced transport activity. 1 Publication1
Mutagenesisi338H → N: Increased affinity for Cd(2+) and Zn(2+) transport. 1 Publication1
Mutagenesisi338H → Q: No effect on transport activity. 1 Publication1
Mutagenesisi412H → A: No effect on transport activity. 1 Publication1
Mutagenesisi443H → A: No effect on transport activity. 1 Publication1
Mutagenesisi446H → A: No effect on transport activity. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002701502 – 463Vacuolar cation/proton exchanger 1Add BLAST462

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi318N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Acetylation, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q39253

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
223870 [Q39253-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q39253

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed at low levels in leaves, stems and flowers.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By cold in leaves. Highly induced by Ca2+ and at low levels by Na+ and Ni2+.2 Publications

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q39253, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q39253, AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with GRXS14 and CXIP4.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
3739, 6 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-1326, CAX1-CAX3 complex
CPX-1428, CAX1 homodimer

Protein interaction database and analysis system

More...
IntActi
Q39253, 1 interactor

STRING: functional protein association networks

More...
STRINGi
3702.AT2G38170.3

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

AlphaFold Protein Structure Database

More...
AlphaFoldDBi
Q39253

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q39253

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni25 – 33Required for autoinhibitory regulation9
Regioni56 – 62Required for interaction with autoinhibitory region7
Regioni87 – 95Required for Ca(2+)/H(+) exchange activity9
Regioni137 – 172Cation selectionSequence analysisAdd BLAST36
Regioni333 – 368Cation selectionSequence analysisAdd BLAST36

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1397, Eukaryota

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_008721_4_2_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q39253

Identification of Orthologs from Complete Genome Data

More...
OMAi
EMNTEPC

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q39253

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.1420.30, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004713, CaH_exchang
IPR004798, CAX-like
IPR004837, NaCa_Exmemb
IPR044880, NCX_ion-bd_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR31503, PTHR31503, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01699, Na_Ca_ex, 2 hits

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00378, cax, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q39253-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGIVTEPWS VAENGNPSIT AKGSSRELRL GRTAHNMSSS SLRKKSDLRV
60 70 80 90 100
IQKVPYKGLK DFLSNLQEVI LGTKLAILFP AIPAAIICTY CGVSQPWIFG
110 120 130 140 150
LSLLGLTPLA ERVSFLTEQL AFYTGPTLGG LLNATCGNAT ELIIAILALT
160 170 180 190 200
NNKVAVVKYS LLGSILSNLL LVLGTSLFCG GIANIRREQR FDRKQADVNF
210 220 230 240 250
FLLLLGFLCH LLPLLVGYLK NGEASAAVLS DMQLSISRGF SIVMLISYIA
260 270 280 290 300
YLVFQLWTHR QLFDAQEQED EYDDDVEQET AVISFWSGFA WLVGMTLVIA
310 320 330 340 350
LLSEYVVATI EEASDKWNLS VSFISIILLP IVGNAAEHAG AVIFAFKNKL
360 370 380 390 400
DISLGVALGS ATQIGLFVVP LTIIVAWILG INMDLNFGPL ETGCLAVSII
410 420 430 440 450
ITAFTLQDGS SHYMKGLVLL LCYFIIAICF FVDKLPQKQN AIHLGHQAMN
460
NVVTATGGGV FSS
Length:463
Mass (Da):50,177
Last modified:January 9, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC7502A62AA51DF0A
GO
Isoform 2 (identifier: Q39253-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     438-463: KQNAIHLGHQAMNNVVTATGGGVFSS → SELVFKCICMLLLGKTIIEAYNTHISNGNASSNKVKTG

Note: May be due to intron retention.Curated
Show »
Length:475
Mass (Da):51,637
Checksum:i7512EF758DC9E1D1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F4IS06F4IS06_ARATH
Vacuolar cation/proton exchanger
CAX1 ATCAX1, cation exchanger 1, RARE COLD INDUCIBLE 4, RCI4, At2g38170
392Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti374I → T in AAB05913 (PubMed:8710949).Curated1
Sequence conflicti396A → V in AAB05913 (PubMed:8710949).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_022343438 – 463KQNAI…GVFSS → SELVFKCICMLLLGKTIIEA YNTHISNGNASSNKVKTG in isoform 2. CuratedAdd BLAST26

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF461691 mRNA Translation: AAL66749.1
AC003028 Genomic DNA Translation: AAC27166.1
CP002685 Genomic DNA Translation: AEC09499.1
CP002685 Genomic DNA Translation: AEC09501.1
AF372938 mRNA Translation: AAK50078.1
U57411 mRNA Translation: AAB05913.2
AK222114 mRNA Translation: BAD95074.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T01249

NCBI Reference Sequences

More...
RefSeqi
NP_181352.1, NM_129373.4 [Q39253-1]
NP_973630.1, NM_201901.4 [Q39253-2]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT2G38170.1; AT2G38170.1; AT2G38170 [Q39253-1]
AT2G38170.3; AT2G38170.3; AT2G38170 [Q39253-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
818395

Gramene; a comparative resource for plants

More...
Gramenei
AT2G38170.1; AT2G38170.1; AT2G38170 [Q39253-1]
AT2G38170.3; AT2G38170.3; AT2G38170 [Q39253-2]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT2G38170

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF461691 mRNA Translation: AAL66749.1
AC003028 Genomic DNA Translation: AAC27166.1
CP002685 Genomic DNA Translation: AEC09499.1
CP002685 Genomic DNA Translation: AEC09501.1
AF372938 mRNA Translation: AAK50078.1
U57411 mRNA Translation: AAB05913.2
AK222114 mRNA Translation: BAD95074.1
PIRiT01249
RefSeqiNP_181352.1, NM_129373.4 [Q39253-1]
NP_973630.1, NM_201901.4 [Q39253-2]

3D structure databases

AlphaFoldDBiQ39253
SMRiQ39253
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi3739, 6 interactors
ComplexPortaliCPX-1326, CAX1-CAX3 complex
CPX-1428, CAX1 homodimer
IntActiQ39253, 1 interactor
STRINGi3702.AT2G38170.3

Protein family/group databases

TCDBi2.A.19.2.3, the ca(2+):cation antiporter (caca) family

PTM databases

iPTMnetiQ39253

Proteomic databases

PaxDbiQ39253
ProteomicsDBi223870 [Q39253-1]

Genome annotation databases

EnsemblPlantsiAT2G38170.1; AT2G38170.1; AT2G38170 [Q39253-1]
AT2G38170.3; AT2G38170.3; AT2G38170 [Q39253-2]
GeneIDi818395
GrameneiAT2G38170.1; AT2G38170.1; AT2G38170 [Q39253-1]
AT2G38170.3; AT2G38170.3; AT2G38170 [Q39253-2]
KEGGiath:AT2G38170

Organism-specific databases

AraportiAT2G38170
TAIRilocus:2042852, AT2G38170

Phylogenomic databases

eggNOGiKOG1397, Eukaryota
HOGENOMiCLU_008721_4_2_1
InParanoidiQ39253
OMAiEMNTEPC
PhylomeDBiQ39253

Enzyme and pathway databases

SABIO-RKiQ39253

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q39253

Gene expression databases

ExpressionAtlasiQ39253, baseline and differential
GenevisibleiQ39253, AT

Family and domain databases

Gene3Di1.20.1420.30, 2 hits
InterProiView protein in InterPro
IPR004713, CaH_exchang
IPR004798, CAX-like
IPR004837, NaCa_Exmemb
IPR044880, NCX_ion-bd_dom_sf
PANTHERiPTHR31503, PTHR31503, 1 hit
PfamiView protein in Pfam
PF01699, Na_Ca_ex, 2 hits
TIGRFAMsiTIGR00378, cax, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCAX1_ARATH
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q39253
Secondary accession number(s): O80442, Q56WC8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 9, 2007
Last sequence update: January 9, 2007
Last modified: May 25, 2022
This is version 134 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again