Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 142 (12 Aug 2020)
Sequence version 2 (05 Sep 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Leucine-rich repeat flightless-interacting protein 1

Gene

LRRFIP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. May control smooth muscle cells proliferation following artery injury through PDGFA repression. May also bind double-stranded RNA. Positively regulates Toll-like receptor (TLR) signaling in response to agonist probably by competing with the negative FLII regulator for MYD88-binding.5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Repressor
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q32MZ4

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1839117, Signaling by cytosolic FGFR1 fusion mutants
R-HSA-3134973, LRR FLII-interacting protein 1 (LRRFIP1) activates type I IFN production
R-HSA-5655302, Signaling by FGFR1 in disease

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Leucine-rich repeat flightless-interacting protein 1
Short name:
LRR FLII-interacting protein 1
Alternative name(s):
GC-binding factor 2
TAR RNA-interacting protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LRRFIP1
Synonyms:GCF2, TRIP
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000124831.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6702, LRRFIP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
603256, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q32MZ4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9208

Open Targets

More...
OpenTargetsi
ENSG00000124831

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30465

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q32MZ4, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL4295838

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LRRFIP1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
114149995

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002483922 – 808Leucine-rich repeat flightless-interacting protein 1Add BLAST807

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylthreonineCombined sources1
Modified residuei16PhosphoserineCombined sources1
Modified residuei115PhosphoserineCombined sources1
Modified residuei116PhosphoserineCombined sources1
Modified residuei120PhosphoserineCombined sources1
Modified residuei124PhosphoserineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki305Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)Combined sources
Modified residuei555PhosphoserineCombined sources1
Modified residuei564PhosphoserineBy similarity1
Modified residuei581PhosphoserineCombined sources1
Cross-linki606Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei618PhosphoserineCombined sources1
Modified residuei638PhosphoserineBy similarity1
Modified residuei676PhosphothreonineCombined sources1
Modified residuei714PhosphoserineCombined sources1
Modified residuei733PhosphoserineCombined sources1
Modified residuei766PhosphoserineCombined sources1
Modified residuei768PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q32MZ4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q32MZ4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q32MZ4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q32MZ4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q32MZ4

PeptideAtlas

More...
PeptideAtlasi
Q32MZ4

PRoteomics IDEntifications database

More...
PRIDEi
Q32MZ4

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
20424
61609 [Q32MZ4-1]
61610 [Q32MZ4-2]
61611 [Q32MZ4-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q32MZ4, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q32MZ4

MetOSite database of methionine sulfoxide sites

More...
MetOSitei
Q32MZ4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q32MZ4

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q32MZ4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed.2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Widely expressed in fetal tissues.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000124831, Expressed in renal medulla and 253 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q32MZ4, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q32MZ4, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000124831, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. May also form higher oligomers.

Interacts with FLII.

Interacts with MYD88. Competes with FLII for MyD88-binding, even in the absence of LPS.

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
114642, 56 interactors

Protein interaction database and analysis system

More...
IntActi
Q32MZ4, 28 interactors

Molecular INTeraction database

More...
MINTi
Q32MZ4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000375857

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q32MZ4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1808
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q32MZ4

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni485 – 584DNA-bindingAdd BLAST100

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili128 – 2501 PublicationAdd BLAST123

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi567 – 593Lys-richAdd BLAST27

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The DNA-binding domain is intrinsically unstructured.1 Publication
The coiled coil mediates dimerization.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the LRRFIP family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2010, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063564

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_018871_2_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q32MZ4

Identification of Orthologs from Complete Genome Data

More...
OMAi
TGKDCVD

Database of Orthologous Groups

More...
OrthoDBi
1434475at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q32MZ4

TreeFam database of animal gene trees

More...
TreeFami
TF314109

Family and domain databases

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...
IDEALi
IID00479

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019139, LRRFIP1/2

The PANTHER Classification System

More...
PANTHERi
PTHR19212, PTHR19212, 3 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09738, LRRFIP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q32MZ4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTSPAAAQSR EIDCLSPEAQ KLAEARLAAK RAARAEAREI RMKELERQQK
60 70 80 90 100
EEDSERYSRR SRRNTSASDE DERMSVGSRG SLRVEERPEK DFTEKGSRNM
110 120 130 140 150
PGLSAATLAS LGGTSSRRGS GDTSISIDTE ASIREIKELN ELKDQIQDVE
160 170 180 190 200
GKYMQGLKEM KDSLAEVEEK YKKAMVSNAQ LDNEKTNFMY QVDTLKDMLL
210 220 230 240 250
ELEEQLAESR RQYEEKNKEF EREKHAHSIL QFQFAEVKEA LKQREEMLEK
260 270 280 290 300
HGIILNSEIA TNGETSDTLN NVGYQGPTKM TKEELNALKS TGDGTLGRAS
310 320 330 340 350
EVEVKNEIVA NVGKREILHN TEKEQHTEDT VKDCVDIEVF PAGENTEDQK
360 370 380 390 400
SSEDTAPFLG TLAGATYEEQ VQSQILESSS LPENTVQVES NEVMGAPDDR
410 420 430 440 450
TRTPLEPSNC WSDLDGGNHT ENVGEAAVTQ VEEQAGTVAS CPLGHSDDTV
460 470 480 490 500
YHDDKCMVEV PQELETSTGH SLEKEFTNQE AAEPKEVPAH STEVGRDHNE
510 520 530 540 550
EEGEETGLRD EKPIKTEVPG SPAGTEGNCQ EATGPSTVDT QNEPLDMKEP
560 570 580 590 600
DEEKSDQQGE ALDSSQKKTK NKKKKNKKKK SPVPVETLKD VKKELTYQNT
610 620 630 640 650
DLSEIKEEEQ VKSTDRKSAV EAQNEVTENP KQKIAAESSE NVDCPENPKI
660 670 680 690 700
KLDGKLDQEG DDVQTAAEEV LADGDTLDFE DDTVQSSGPR AGGEELDEGV
710 720 730 740 750
AKDNAKIDGA TQSSPAEPKS EDADRCTLPE HESPSQDISD ACEAESTERC
760 770 780 790 800
EMSEHPSQTV RKALDSNSLE NDDLSAPGRE PGHFNPESRE DTRGGNEKGK

SKEDCTMS
Length:808
Mass (Da):89,253
Last modified:September 5, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4E6140DF2471A7C9
GO
Isoform 2 (identifier: Q32MZ4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     137-160: Missing.

Show »
Length:784
Mass (Da):86,404
Checksum:iDDB6D45C670DBE97
GO
Isoform 3 (identifier: Q32MZ4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     52-83: Missing.
     137-160: Missing.

Show »
Length:752
Mass (Da):82,689
Checksum:iF99016BC7CE54A60
GO
Isoform 4 (identifier: Q32MZ4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MTSPAAAQSREIDCLSPEAQKL → MDMGTQGSGRKRLPNRERLTAEDDALNQIARE
     51-51: E → EIYQVQKKYYGLDTKWGDIEQWM
     83-83: R → RSQPDLEYGG...RASSARASPV
     249-249: E → EEIRQLQQKQASSIREISDLQETIEWKDKKIGALERQKEFFDSVRSERDDLREEVVMLKEELK
     297-450: GRASEVEVKN...CPLGHSDDTV → DIRLKKLVDE...ANRSALLSQQ
     451-808: Missing.

Show »
Length:640
Mass (Da):73,060
Checksum:iE7B967AF138F79C3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JTC6C9JTC6_HUMAN
Leucine-rich repeat flightless-inte...
LRRFIP1
149Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH01385 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAY14672 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti17P → L in AAC32037 (PubMed:9705290).Curated1
Sequence conflicti26R → W in AAC32037 (PubMed:9705290).Curated1
Sequence conflicti125I → F in CAA11076 (PubMed:9671805).Curated1
Sequence conflicti327T → A in AAC32037 (PubMed:9705290).Curated1
Sequence conflicti562L → F in AAI08915 (PubMed:15489334).Curated1
Sequence conflicti665T → P in AAC32037 (PubMed:9705290).Curated1
Sequence conflicti684V → A in AAC32037 (PubMed:9705290).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03603768S → C in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_027291275Q → R. Corresponds to variant dbSNP:rs3213869Ensembl.1
Natural variantiVAR_027292418N → S. Corresponds to variant dbSNP:rs2001301Ensembl.1
Natural variantiVAR_027293609E → K. Corresponds to variant dbSNP:rs761312145Ensembl.1
Natural variantiVAR_056111633K → E. Corresponds to variant dbSNP:rs3739041Ensembl.1
Natural variantiVAR_027294645P → L. Corresponds to variant dbSNP:rs3739040Ensembl.1
Natural variantiVAR_027295779R → G. Corresponds to variant dbSNP:rs3739039Ensembl.1
Natural variantiVAR_027296783H → D. Corresponds to variant dbSNP:rs3739038Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0468091 – 22MTSPA…EAQKL → MDMGTQGSGRKRLPNRERLT AEDDALNQIARE in isoform 4. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_04681051E → EIYQVQKKYYGLDTKWGDIE QWM in isoform 4. 1 Publication1
Alternative sequenceiVSP_02026452 – 83Missing in isoform 3. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_04681183R → RSQPDLEYGGPYAWTNGYDG ELYGSQSLNRRSGRPSCLYS AARPSGSYRASVLDEGSFGG TRRGSTSGSRAPSEYSGHLN SSSRASSRASSARASPV in isoform 4. 1 Publication1
Alternative sequenceiVSP_020265137 – 160Missing in isoform 2 and isoform 3. 3 PublicationsAdd BLAST24
Alternative sequenceiVSP_046812249E → EEIRQLQQKQASSIREISDL QETIEWKDKKIGALERQKEF FDSVRSERDDLREEVVMLKE ELK in isoform 4. 1 Publication1
Alternative sequenceiVSP_046813297 – 450GRASE…SDDTV → DIRLKKLVDERECLLEQIKK LKGQLEERQKIGKLDNLRSE DDVLENGTDMHVMDLQRDAN RQISDLKFKLAKSEQEITAL EQNVIRLESQVSRYKSAAEN AEKIEDELKAEKRKLQRELR SALDKTEELEVSNGHLVKRL EKMKANRSALLSQQ in isoform 4. 1 PublicationAdd BLAST154
Alternative sequenceiVSP_046814451 – 808Missing in isoform 4. 1 PublicationAdd BLAST358

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U69609 mRNA Translation: AAC32037.1
AJ223075 mRNA Translation: CAA11076.1
AC012076 Genomic DNA Translation: AAY14672.1 Sequence problems.
AC096574 Genomic DNA No translation available.
BC001385 mRNA Translation: AAH01385.1 Sequence problems.
BC108913 mRNA Translation: AAI08914.1
BC108914 mRNA Translation: AAI08915.1
AF115510 mRNA Translation: AAD41258.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2521.1 [Q32MZ4-2]
CCDS46551.1 [Q32MZ4-4]
CCDS46552.1 [Q32MZ4-1]
CCDS46553.1 [Q32MZ4-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001131022.1, NM_001137550.1 [Q32MZ4-4]
NP_001131024.1, NM_001137552.1 [Q32MZ4-1]
NP_001131025.1, NM_001137553.1 [Q32MZ4-3]
NP_004726.2, NM_004735.3 [Q32MZ4-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000244815; ENSP00000244815; ENSG00000124831 [Q32MZ4-2]
ENST00000289175; ENSP00000289175; ENSG00000124831 [Q32MZ4-3]
ENST00000308482; ENSP00000310109; ENSG00000124831 [Q32MZ4-4]
ENST00000392000; ENSP00000375857; ENSG00000124831 [Q32MZ4-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9208

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9208

UCSC genome browser

More...
UCSCi
uc002vxc.4, human [Q32MZ4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U69609 mRNA Translation: AAC32037.1
AJ223075 mRNA Translation: CAA11076.1
AC012076 Genomic DNA Translation: AAY14672.1 Sequence problems.
AC096574 Genomic DNA No translation available.
BC001385 mRNA Translation: AAH01385.1 Sequence problems.
BC108913 mRNA Translation: AAI08914.1
BC108914 mRNA Translation: AAI08915.1
AF115510 mRNA Translation: AAD41258.1
CCDSiCCDS2521.1 [Q32MZ4-2]
CCDS46551.1 [Q32MZ4-4]
CCDS46552.1 [Q32MZ4-1]
CCDS46553.1 [Q32MZ4-3]
RefSeqiNP_001131022.1, NM_001137550.1 [Q32MZ4-4]
NP_001131024.1, NM_001137552.1 [Q32MZ4-1]
NP_001131025.1, NM_001137553.1 [Q32MZ4-3]
NP_004726.2, NM_004735.3 [Q32MZ4-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4H22X-ray2.89A/B/C/D162-249[»]
SMRiQ32MZ4
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi114642, 56 interactors
IntActiQ32MZ4, 28 interactors
MINTiQ32MZ4
STRINGi9606.ENSP00000375857

Chemistry databases

ChEMBLiCHEMBL4295838

PTM databases

GlyGeniQ32MZ4, 1 site, 1 O-linked glycan (1 site)
iPTMnetiQ32MZ4
MetOSiteiQ32MZ4
PhosphoSitePlusiQ32MZ4
SwissPalmiQ32MZ4

Polymorphism and mutation databases

BioMutaiLRRFIP1
DMDMi114149995

Proteomic databases

EPDiQ32MZ4
jPOSTiQ32MZ4
MassIVEiQ32MZ4
MaxQBiQ32MZ4
PaxDbiQ32MZ4
PeptideAtlasiQ32MZ4
PRIDEiQ32MZ4
ProteomicsDBi20424
61609 [Q32MZ4-1]
61610 [Q32MZ4-2]
61611 [Q32MZ4-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
1000, 322 antibodies

The DNASU plasmid repository

More...
DNASUi
9208

Genome annotation databases

EnsembliENST00000244815; ENSP00000244815; ENSG00000124831 [Q32MZ4-2]
ENST00000289175; ENSP00000289175; ENSG00000124831 [Q32MZ4-3]
ENST00000308482; ENSP00000310109; ENSG00000124831 [Q32MZ4-4]
ENST00000392000; ENSP00000375857; ENSG00000124831 [Q32MZ4-1]
GeneIDi9208
KEGGihsa:9208
UCSCiuc002vxc.4, human [Q32MZ4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9208
DisGeNETi9208
EuPathDBiHostDB:ENSG00000124831.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LRRFIP1
HGNCiHGNC:6702, LRRFIP1
HPAiENSG00000124831, Low tissue specificity
MIMi603256, gene
neXtProtiNX_Q32MZ4
OpenTargetsiENSG00000124831
PharmGKBiPA30465

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2010, Eukaryota
GeneTreeiENSGT00530000063564
HOGENOMiCLU_018871_2_1_1
InParanoidiQ32MZ4
OMAiTGKDCVD
OrthoDBi1434475at2759
PhylomeDBiQ32MZ4
TreeFamiTF314109

Enzyme and pathway databases

PathwayCommonsiQ32MZ4
ReactomeiR-HSA-1839117, Signaling by cytosolic FGFR1 fusion mutants
R-HSA-3134973, LRR FLII-interacting protein 1 (LRRFIP1) activates type I IFN production
R-HSA-5655302, Signaling by FGFR1 in disease

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
9208, 7 hits in 875 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LRRFIP1, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
LRRFIP1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9208
PharosiQ32MZ4, Tbio

Protein Ontology

More...
PROi
PR:Q32MZ4
RNActiQ32MZ4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000124831, Expressed in renal medulla and 253 other tissues
ExpressionAtlasiQ32MZ4, baseline and differential
GenevisibleiQ32MZ4, HS

Family and domain databases

IDEALiIID00479
InterProiView protein in InterPro
IPR019139, LRRFIP1/2
PANTHERiPTHR19212, PTHR19212, 3 hits
PfamiView protein in Pfam
PF09738, LRRFIP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLRRF1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q32MZ4
Secondary accession number(s): E9PGZ2
, O75766, O75799, Q32MZ5, Q53T49, Q6PKG2, Q9Y607
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: September 5, 2006
Last modified: August 12, 2020
This is version 142 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families
  6. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again