Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 123 (12 Aug 2020)
Sequence version 1 (06 Dec 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Anoctamin-4

Gene

ANO4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Has calcium-dependent phospholipid scramblase activity; scrambles phosphatidylserine, phosphatidylcholine and galactosylceramide (By similarity). Does not exhibit calcium-activated chloride channel (CaCC) activity (By similarity).By similarity

Miscellaneous

The term 'anoctamin' was coined because these channels are anion selective and have eight (OCT) transmembrane segments. There is some dissatisfaction in the field with the Ano nomenclature because it is not certain that all the members of this family are anion channels or have the 8-transmembrane topology.

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processLipid transport, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q32M45

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2672351, Stimuli-sensing channels

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.A.17.1.29, the calcium-dependent chloride channel (ca-clc) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Anoctamin-4
Alternative name(s):
Transmembrane protein 16D
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ANO4
Synonyms:TMEM16D
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000151572.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23837, ANO4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610111, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q32M45

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 352ExtracellularSequence analysisAdd BLAST352
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei353 – 373HelicalSequence analysisAdd BLAST21
Topological domaini374 – 424CytoplasmicSequence analysisAdd BLAST51
Transmembranei425 – 445HelicalSequence analysisAdd BLAST21
Topological domaini446 – 505ExtracellularSequence analysisAdd BLAST60
Transmembranei506 – 526HelicalSequence analysisAdd BLAST21
Topological domaini527 – 547CytoplasmicSequence analysisAdd BLAST21
Transmembranei548 – 568HelicalSequence analysisAdd BLAST21
Topological domaini569 – 595ExtracellularSequence analysisAdd BLAST27
Transmembranei596 – 616HelicalSequence analysisAdd BLAST21
Topological domaini617 – 715CytoplasmicSequence analysisAdd BLAST99
Transmembranei716 – 736HelicalSequence analysisAdd BLAST21
Topological domaini737 – 768ExtracellularSequence analysisAdd BLAST32
Transmembranei769 – 789HelicalSequence analysisAdd BLAST21
Topological domaini790 – 885CytoplasmicSequence analysisAdd BLAST96
Transmembranei886 – 906HelicalSequence analysisAdd BLAST21
Topological domaini907 – 955ExtracellularSequence analysisAdd BLAST49

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
121601

Open Targets

More...
OpenTargetsi
ENSG00000151572

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164715582

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q32M45, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ANO4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
121942141

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002886501 – 955Anoctamin-4Add BLAST955

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi83N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi105N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi257N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi288N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q32M45

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q32M45

PeptideAtlas

More...
PeptideAtlasi
Q32M45

PRoteomics IDEntifications database

More...
PRIDEi
Q32M45

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
61589 [Q32M45-1]
61590 [Q32M45-2]
61591 [Q32M45-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q32M45, 4 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q32M45

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q32M45

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000151572, Expressed in corpus callosum and 145 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q32M45, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q32M45, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000151572, Tissue enhanced (adrenal gland, brain, seminal vesicle)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
125740, 14 interactors

Protein interaction database and analysis system

More...
IntActi
Q32M45, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000376703

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q32M45, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q32M45

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi462 – 467Poly-Glu6

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the anoctamin family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2514, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158600

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_006685_1_3_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q32M45

KEGG Orthology (KO)

More...
KOi
K19499

Identification of Orthologs from Complete Genome Data

More...
OMAi
RNVQYWK

Database of Orthologous Groups

More...
OrthoDBi
1263362at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q32M45

TreeFam database of animal gene trees

More...
TreeFami
TF314265

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR032394, Anoct_dimer
IPR007632, Anoctamin
IPR031293, Anoctamin-4

The PANTHER Classification System

More...
PANTHERi
PTHR12308, PTHR12308, 1 hit
PTHR12308:SF28, PTHR12308:SF28, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16178, Anoct_dimer, 1 hit
PF04547, Anoctamin, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q32M45-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEASSSGITN GKTKVFHPEG GVDLQGYQLD MQILPDGPKS DVDFSEILNA
60 70 80 90 100
IQEMAKDVNI LFDELEAVSS PCKDDDSLLH PGNLTSTSDD ASRLEAGGET
110 120 130 140 150
VPERNKSNGL YFRDGKCRID YILVYRKSNP QTEKREVFER NIRAEGLQME
160 170 180 190 200
KESSLINSDI IFVKLHAPWE VLGRYAEQMN VRMPFRRKIY YLPRRYKFMS
210 220 230 240 250
RIDKQISRFR RWLPKKPMRL DKETLPDLEE NDCYTAPFSQ QRIHHFIIHN
260 270 280 290 300
KETFFNNATR SRIVHHILQR IKYEEGKNKI GLNRLLTNGS YEAAFPLHEG
310 320 330 340 350
SYRSKNSIRT HGAENHRHLL YECWASWGVW YKYQPLDLVR RYFGEKIGLY
360 370 380 390 400
FAWLGWYTGM LFPAAFIGLF VFLYGVTTLD HSQVSKEVCQ ATDIIMCPVC
410 420 430 440 450
DKYCPFMRLS DSCVYAKVTH LFDNGATVFF AVFMAVWATV FLEFWKRRRA
460 470 480 490 500
VIAYDWDLID WEEEEEEIRP QFEAKYSKKE RMNPISGKPE PYQAFTDKCS
510 520 530 540 550
RLIVSASGIF FMICVVIAAV FGIVIYRVVT VSTFAAFKWA LIRNNSQVAT
560 570 580 590 600
TGTAVCINFC IIMLLNVLYE KVALLLTNLE QPRTESEWEN SFTLKMFLFQ
610 620 630 640 650
FVNLNSSTFY IAFFLGRFTG HPGAYLRLIN RWRLEECHPS GCLIDLCMQM
660 670 680 690 700
GIIMVLKQTW NNFMELGYPL IQNWWTRRKV RQEHGPERKI SFPQWEKDYN
710 720 730 740 750
LQPMNAYGLF DEYLEMILQF GFTTIFVAAF PLAPLLALLN NIIEIRLDAY
760 770 780 790 800
KFVTQWRRPL ASRAKDIGIW YGILEGIGIL SVITNAFVIA ITSDFIPRLV
810 820 830 840 850
YAYKYGPCAG QGEAGQKCMV GYVNASLSVF RISDFENRSE PESDGSEFSG
860 870 880 890 900
TPLKYCRYRD YRDPPHSLVP YGYTLQFWHV LAARLAFIIV FEHLVFCIKH
910 920 930 940 950
LISYLIPDLP KDLRDRMRRE KYLIQEMMYE AELERLQKER KERKKNGKAH

HNEWP
Length:955
Mass (Da):111,462
Last modified:December 6, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9A9348C61A4F20AF
GO
Isoform 2 (identifier: Q32M45-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-54: EGGVDLQGYQLDMQILPDGPKSDVDFSEILNAIQEM → V

Show »
Length:920
Mass (Da):107,612
Checksum:iBAA2D80DE848F4F9
GO
Isoform 3 (identifier: Q32M45-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-433: Missing.
     466-512: Missing.

Show »
Length:475
Mass (Da):55,719
Checksum:iE6FC96E22BA79519
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2R8Y532A0A2R8Y532_HUMAN
Anoctamin
ANO4
1,121Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VW62F8VW62_HUMAN
Anoctamin-4
ANO4
356Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VUH1F8VUH1_HUMAN
Anoctamin-4
ANO4
11Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC03688 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti209F → L in BAC03704 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_032453115G → A. Corresponds to variant dbSNP:rs34162417Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0257411 – 433Missing in isoform 3. 1 PublicationAdd BLAST433
Alternative sequenceiVSP_02574219 – 54EGGVD…AIQEM → V in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_025743466 – 512Missing in isoform 3. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK091540 mRNA Translation: BAC03688.1 Different initiation.
AK091591 mRNA Translation: BAC03704.1
AK092596 mRNA Translation: BAC03924.1
BC109308 mRNA Translation: AAI09309.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31884.1 [Q32M45-2]
CCDS66445.1 [Q32M45-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001273544.1, NM_001286615.1 [Q32M45-1]
NP_001273545.1, NM_001286616.1 [Q32M45-1]
NP_849148.2, NM_178826.3 [Q32M45-2]
XP_011536216.1, XM_011537914.2 [Q32M45-2]
XP_016874297.1, XM_017018808.1 [Q32M45-2]
XP_016874298.1, XM_017018809.1
XP_016874299.1, XM_017018810.1 [Q32M45-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000392977; ENSP00000376703; ENSG00000151572 [Q32M45-1]
ENST00000392979; ENSP00000376705; ENSG00000151572 [Q32M45-2]
ENST00000570509; ENSP00000471431; ENSG00000262139
ENST00000573650; ENSP00000469449; ENSG00000262139
ENST00000575847; ENSP00000470039; ENSG00000262139
ENST00000594618; ENSP00000471210; ENSG00000262139

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
121601

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:121601

UCSC genome browser

More...
UCSCi
uc001thw.3, human [Q32M45-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK091540 mRNA Translation: BAC03688.1 Different initiation.
AK091591 mRNA Translation: BAC03704.1
AK092596 mRNA Translation: BAC03924.1
BC109308 mRNA Translation: AAI09309.1
CCDSiCCDS31884.1 [Q32M45-2]
CCDS66445.1 [Q32M45-1]
RefSeqiNP_001273544.1, NM_001286615.1 [Q32M45-1]
NP_001273545.1, NM_001286616.1 [Q32M45-1]
NP_849148.2, NM_178826.3 [Q32M45-2]
XP_011536216.1, XM_011537914.2 [Q32M45-2]
XP_016874297.1, XM_017018808.1 [Q32M45-2]
XP_016874298.1, XM_017018809.1
XP_016874299.1, XM_017018810.1 [Q32M45-2]

3D structure databases

SMRiQ32M45
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi125740, 14 interactors
IntActiQ32M45, 2 interactors
STRINGi9606.ENSP00000376703

Protein family/group databases

TCDBi1.A.17.1.29, the calcium-dependent chloride channel (ca-clc) family

PTM databases

GlyGeniQ32M45, 4 sites
iPTMnetiQ32M45
PhosphoSitePlusiQ32M45

Polymorphism and mutation databases

BioMutaiANO4
DMDMi121942141

Proteomic databases

jPOSTiQ32M45
PaxDbiQ32M45
PeptideAtlasiQ32M45
PRIDEiQ32M45
ProteomicsDBi61589 [Q32M45-1]
61590 [Q32M45-2]
61591 [Q32M45-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
66428, 85 antibodies

Genome annotation databases

EnsembliENST00000392977; ENSP00000376703; ENSG00000151572 [Q32M45-1]
ENST00000392979; ENSP00000376705; ENSG00000151572 [Q32M45-2]
ENST00000570509; ENSP00000471431; ENSG00000262139
ENST00000573650; ENSP00000469449; ENSG00000262139
ENST00000575847; ENSP00000470039; ENSG00000262139
ENST00000594618; ENSP00000471210; ENSG00000262139
GeneIDi121601
KEGGihsa:121601
UCSCiuc001thw.3, human [Q32M45-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
121601
DisGeNETi121601
EuPathDBiHostDB:ENSG00000151572.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ANO4
HGNCiHGNC:23837, ANO4
HPAiENSG00000151572, Tissue enhanced (adrenal gland, brain, seminal vesicle)
MIMi610111, gene
neXtProtiNX_Q32M45
OpenTargetsiENSG00000151572
PharmGKBiPA164715582

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2514, Eukaryota
GeneTreeiENSGT00940000158600
HOGENOMiCLU_006685_1_3_1
InParanoidiQ32M45
KOiK19499
OMAiRNVQYWK
OrthoDBi1263362at2759
PhylomeDBiQ32M45
TreeFamiTF314265

Enzyme and pathway databases

PathwayCommonsiQ32M45
ReactomeiR-HSA-2672351, Stimuli-sensing channels

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
121601, 4 hits in 861 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ANO4, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
121601
PharosiQ32M45, Tbio

Protein Ontology

More...
PROi
PR:Q32M45
RNActiQ32M45, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000151572, Expressed in corpus callosum and 145 other tissues
ExpressionAtlasiQ32M45, baseline and differential
GenevisibleiQ32M45, HS

Family and domain databases

InterProiView protein in InterPro
IPR032394, Anoct_dimer
IPR007632, Anoctamin
IPR031293, Anoctamin-4
PANTHERiPTHR12308, PTHR12308, 1 hit
PTHR12308:SF28, PTHR12308:SF28, 1 hit
PfamiView protein in Pfam
PF16178, Anoct_dimer, 1 hit
PF04547, Anoctamin, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiANO4_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q32M45
Secondary accession number(s): Q8NAJ0, Q8NB39, Q8NB53
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: December 6, 2005
Last modified: August 12, 2020
This is version 123 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again