Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Anoctamin-4

Gene

ANO4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Has calcium-dependent phospholipid scramblase activity; scrambles phosphatidylserine, phosphatidylcholine and galactosylceramide. Does not exhibit calcium-activated chloride channel (CaCC) activity.By similarity

Miscellaneous

The term 'anoctamin' was coined because these channels are anion selective and have eight (OCT) transmembrane segments. There is some dissatisfaction in the field with the Ano nomenclature because it is not certain that all the members of this family are anion channels or have the 8-transmembrane topology.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processLipid transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-2672351 Stimuli-sensing channels

Names & Taxonomyi

Protein namesi
Recommended name:
Anoctamin-4
Alternative name(s):
Transmembrane protein 16D
Gene namesi
Name:ANO4
Synonyms:TMEM16D
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000151572.16
HGNCiHGNC:23837 ANO4
MIMi610111 gene
neXtProtiNX_Q32M45

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 352ExtracellularSequence analysisAdd BLAST352
Transmembranei353 – 373HelicalSequence analysisAdd BLAST21
Topological domaini374 – 424CytoplasmicSequence analysisAdd BLAST51
Transmembranei425 – 445HelicalSequence analysisAdd BLAST21
Topological domaini446 – 505ExtracellularSequence analysisAdd BLAST60
Transmembranei506 – 526HelicalSequence analysisAdd BLAST21
Topological domaini527 – 547CytoplasmicSequence analysisAdd BLAST21
Transmembranei548 – 568HelicalSequence analysisAdd BLAST21
Topological domaini569 – 595ExtracellularSequence analysisAdd BLAST27
Transmembranei596 – 616HelicalSequence analysisAdd BLAST21
Topological domaini617 – 715CytoplasmicSequence analysisAdd BLAST99
Transmembranei716 – 736HelicalSequence analysisAdd BLAST21
Topological domaini737 – 768ExtracellularSequence analysisAdd BLAST32
Transmembranei769 – 789HelicalSequence analysisAdd BLAST21
Topological domaini790 – 885CytoplasmicSequence analysisAdd BLAST96
Transmembranei886 – 906HelicalSequence analysisAdd BLAST21
Topological domaini907 – 955ExtracellularSequence analysisAdd BLAST49

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi121601
OpenTargetsiENSG00000151572
PharmGKBiPA164715582

Polymorphism and mutation databases

BioMutaiANO4
DMDMi121942141

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002886501 – 955Anoctamin-4Add BLAST955

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi83N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi105N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi257N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi288N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ32M45
PeptideAtlasiQ32M45
PRIDEiQ32M45
ProteomicsDBi61589
61590 [Q32M45-2]
61591 [Q32M45-3]

PTM databases

iPTMnetiQ32M45
PhosphoSitePlusiQ32M45

Expressioni

Gene expression databases

BgeeiENSG00000151572
CleanExiHS_ANO4
ExpressionAtlasiQ32M45 baseline and differential
GenevisibleiQ32M45 HS

Organism-specific databases

HPAiHPA053412

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi125740, 13 interactors
STRINGi9606.ENSP00000376705

Structurei

3D structure databases

ProteinModelPortaliQ32M45
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi462 – 467Poly-Glu6

Sequence similaritiesi

Belongs to the anoctamin family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2514 Eukaryota
ENOG410XS4S LUCA
GeneTreeiENSGT00760000119015
HOGENOMiHOG000006509
HOVERGENiHBG069519
InParanoidiQ32M45
KOiK19499
OMAiHHILQRV
OrthoDBiEOG091G01JF
PhylomeDBiQ32M45
TreeFamiTF314265

Family and domain databases

InterProiView protein in InterPro
IPR032394 Anoct_dimer
IPR007632 Anoctamin
IPR031293 Anoctamin-4
PANTHERiPTHR12308 PTHR12308, 1 hit
PTHR12308:SF28 PTHR12308:SF28, 1 hit
PfamiView protein in Pfam
PF16178 Anoct_dimer, 1 hit
PF04547 Anoctamin, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q32M45-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEASSSGITN GKTKVFHPEG GVDLQGYQLD MQILPDGPKS DVDFSEILNA
60 70 80 90 100
IQEMAKDVNI LFDELEAVSS PCKDDDSLLH PGNLTSTSDD ASRLEAGGET
110 120 130 140 150
VPERNKSNGL YFRDGKCRID YILVYRKSNP QTEKREVFER NIRAEGLQME
160 170 180 190 200
KESSLINSDI IFVKLHAPWE VLGRYAEQMN VRMPFRRKIY YLPRRYKFMS
210 220 230 240 250
RIDKQISRFR RWLPKKPMRL DKETLPDLEE NDCYTAPFSQ QRIHHFIIHN
260 270 280 290 300
KETFFNNATR SRIVHHILQR IKYEEGKNKI GLNRLLTNGS YEAAFPLHEG
310 320 330 340 350
SYRSKNSIRT HGAENHRHLL YECWASWGVW YKYQPLDLVR RYFGEKIGLY
360 370 380 390 400
FAWLGWYTGM LFPAAFIGLF VFLYGVTTLD HSQVSKEVCQ ATDIIMCPVC
410 420 430 440 450
DKYCPFMRLS DSCVYAKVTH LFDNGATVFF AVFMAVWATV FLEFWKRRRA
460 470 480 490 500
VIAYDWDLID WEEEEEEIRP QFEAKYSKKE RMNPISGKPE PYQAFTDKCS
510 520 530 540 550
RLIVSASGIF FMICVVIAAV FGIVIYRVVT VSTFAAFKWA LIRNNSQVAT
560 570 580 590 600
TGTAVCINFC IIMLLNVLYE KVALLLTNLE QPRTESEWEN SFTLKMFLFQ
610 620 630 640 650
FVNLNSSTFY IAFFLGRFTG HPGAYLRLIN RWRLEECHPS GCLIDLCMQM
660 670 680 690 700
GIIMVLKQTW NNFMELGYPL IQNWWTRRKV RQEHGPERKI SFPQWEKDYN
710 720 730 740 750
LQPMNAYGLF DEYLEMILQF GFTTIFVAAF PLAPLLALLN NIIEIRLDAY
760 770 780 790 800
KFVTQWRRPL ASRAKDIGIW YGILEGIGIL SVITNAFVIA ITSDFIPRLV
810 820 830 840 850
YAYKYGPCAG QGEAGQKCMV GYVNASLSVF RISDFENRSE PESDGSEFSG
860 870 880 890 900
TPLKYCRYRD YRDPPHSLVP YGYTLQFWHV LAARLAFIIV FEHLVFCIKH
910 920 930 940 950
LISYLIPDLP KDLRDRMRRE KYLIQEMMYE AELERLQKER KERKKNGKAH

HNEWP
Length:955
Mass (Da):111,462
Last modified:December 6, 2005 - v1
Checksum:i9A9348C61A4F20AF
GO
Isoform 2 (identifier: Q32M45-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-54: EGGVDLQGYQLDMQILPDGPKSDVDFSEILNAIQEM → V

Show »
Length:920
Mass (Da):107,612
Checksum:iBAA2D80DE848F4F9
GO
Isoform 3 (identifier: Q32M45-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-433: Missing.
     466-512: Missing.

Note: No experimental confirmation available.
Show »
Length:475
Mass (Da):55,719
Checksum:iE6FC96E22BA79519
GO

Sequence cautioni

The sequence BAC03688 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti209F → L in BAC03704 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_032453115G → A. Corresponds to variant dbSNP:rs34162417Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0257411 – 433Missing in isoform 3. 1 PublicationAdd BLAST433
Alternative sequenceiVSP_02574219 – 54EGGVD…AIQEM → V in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_025743466 – 512Missing in isoform 3. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK091540 mRNA Translation: BAC03688.1 Different initiation.
AK091591 mRNA Translation: BAC03704.1
AK092596 mRNA Translation: BAC03924.1
BC109308 mRNA Translation: AAI09309.1
CCDSiCCDS31884.1 [Q32M45-2]
CCDS66445.1 [Q32M45-1]
RefSeqiNP_001273544.1, NM_001286615.1 [Q32M45-1]
NP_001273545.1, NM_001286616.1 [Q32M45-1]
NP_849148.2, NM_178826.3 [Q32M45-2]
XP_011536216.1, XM_011537914.2 [Q32M45-2]
XP_016874297.1, XM_017018808.1 [Q32M45-2]
XP_016874298.1, XM_017018809.1 [Q32M45-1]
XP_016874299.1, XM_017018810.1 [Q32M45-2]
UniGeneiHs.58785

Genome annotation databases

EnsembliENST00000392977; ENSP00000376703; ENSG00000151572 [Q32M45-1]
ENST00000392979; ENSP00000376705; ENSG00000151572 [Q32M45-2]
ENST00000570509; ENSP00000471431; ENSG00000262139
ENST00000573650; ENSP00000469449; ENSG00000262139
ENST00000575847; ENSP00000470039; ENSG00000262139
ENST00000594618; ENSP00000471210; ENSG00000262139
GeneIDi121601
KEGGihsa:121601
UCSCiuc001thw.3 human [Q32M45-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiANO4_HUMAN
AccessioniPrimary (citable) accession number: Q32M45
Secondary accession number(s): Q8NAJ0, Q8NB39, Q8NB53
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: December 6, 2005
Last modified: June 20, 2018
This is version 106 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health