Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).
Entry version 101 (02 Dec 2020)
Sequence version 1 (06 Dec 2005)
Previous versions | rss
Add a publicationFeedback
Protein

Neutral ceramidase 2

Gene

NCER2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Protein inferred from homologyi <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei330NucleophileBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
Biological processLipid metabolism, Sphingolipid metabolism

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
ARA:AT2G38010-MONOMER

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neutral ceramidase 21 Publication (EC:3.5.1.23By similarity)
Short name:
AtNCER21 Publication
Short name:
N-CDase 21 Publication
Short name:
NCDase 21 Publication
Alternative name(s):
Acylsphingosine deacylase 2
N-acylsphingosine amidohydrolase 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NCER21 Publication
Ordered Locus Names:At2g38010Imported
ORF Names:T8P21.8Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT2G38010

The Arabidopsis Information Resource

More...
TAIRi
locus:2065685, AT2G38010

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 25Sequence analysisAdd BLAST25
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000024711026 – 757Neutral ceramidase 2Add BLAST732

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi311N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi348N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi657N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q304B9

PRoteomics IDEntifications database

More...
PRIDEi
Q304B9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
251251 [Q304B9-1]

PTM databases

MetOSite database of methionine sulfoxide sites

More...
MetOSitei
Q304B9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q304B9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q304B9, AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
3723, 1 interactor

STRING: functional protein association networks

More...
STRINGi
3702.AT2G38010.2

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q304B9

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the neutral ceramidase family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2232, Eukaryota

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_011300_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q304B9

Database of Orthologous Groups

More...
OrthoDBi
967085at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q304B9

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.2300, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006823, Ceramidase_alk
IPR038445, NCDase_C_sf
IPR031331, NEUT/ALK_ceramidase_C
IPR031329, NEUT/ALK_ceramidase_N

The PANTHER Classification System

More...
PANTHERi
PTHR12670, PTHR12670, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04734, Ceramidase_alk, 1 hit
PF17048, Ceramidse_alk_C, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: A number of isoforms are produced. According to EST sequences.

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q304B9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAVSLPLFQF ILFLLLLLLS RTVYAYLIGV GSYDITGPAA DVNMMGYANS
60 70 80 90 100
DQIASGIHFR LRARAFIVAE PQGNRVVFVN LDACMASQIV TIKVLERLKA
110 120 130 140 150
RYGELYTEKN VAISGIHTHA GPGGYLQYVT YIVTSLGFVR QSFDVVVNGI
160 170 180 190 200
EQSIVQAHES LRPGSAFVNK GDLLDAGVNR SPSSYLNNPA AERSKYKYDV
210 220 230 240 250
DKEMTLVKFV DSQLGPTGSF NWFATHGTSM SRTNSLISGD NKGAAARFME
260 270 280 290 300
DWFENGQKNS VSSRNIPRRV STIVSDFSRN RDRLLDIAAT YKSSRGHSVD
310 320 330 340 350
KSLDVKTRVR NGSKRKFVSA FCQSNCGDVS PNTLGTFCID TGLPCDFNHS
360 370 380 390 400
TCNGQNELCY GRGPGYPDEF ESTRIIGEKQ FKMAVELFNK ATEKLQGKIG
410 420 430 440 450
YQHAYLDFSN LDVTVPKAGG GSETVKTCPA AMGFGFAAGT TDGPGAFDFK
460 470 480 490 500
QGDDQGNVFW RLVRNVLRTP GPEQVQCQKP KPILLDTGEM KEPYDWAPSI
510 520 530 540 550
LPIQILRIGQ LVILSVPGEF TTMAGRRLRD AIKSFLISSD PKEFSNNMHV
560 570 580 590 600
VIAGLTNTYS QYIATFEEYE VQRYEGASTL YGRHTLTAYI QEFKKLATAL
610 620 630 640 650
VNGLTLPRGP QPPDLLDKQI SLLSPVVVDS TPLGVKFGDV KADVPPKSTF
660 670 680 690 700
RRGQQVNATF WSGCPRNDLM TEGSFAVVET LREGGKWAPV YDDDDFSLKF
710 720 730 740 750
KWSRPAKLSS ESQATIEWRV PESAVAGVYR IRHYGASKSL FGSISSFSGS

SSAFVVV
Length:757
Mass (Da):83,264
Last modified:December 6, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6586793BC42B1E42
GO
Isoform 2 (identifier: Q304B9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     282-282: D → ESYPFLELPNVAILYIAVAERLMWKVMVLFYFVSES

Show »
Length:792
Mass (Da):87,400
Checksum:iDDF77A8C13AC7A68
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A178VXV8A0A178VXV8_ARATH
Neutral ceramidase
At2g38010, T8P21.8, T8P21_8
757Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_058912282D → ESYPFLELPNVAILYIAVAE RLMWKVMVLFYFVSES in isoform 2. 1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
CP002685 Genomic DNA Translation: AEC09477.1
CP002685 Genomic DNA Translation: AEC09478.1

Protein sequence database of the Protein Information Resource

More...
PIRi
H84799

NCBI Reference Sequences

More...
RefSeqi
NP_181337.2, NM_129358.3 [Q304B9-1]
NP_973628.1, NM_201899.2 [Q304B9-2]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT2G38010.1; AT2G38010.1; AT2G38010 [Q304B9-1]
AT2G38010.2; AT2G38010.2; AT2G38010 [Q304B9-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
818379

Gramene; a comparative resource for plants

More...
Gramenei
AT2G38010.1; AT2G38010.1; AT2G38010 [Q304B9-1]
AT2G38010.2; AT2G38010.2; AT2G38010 [Q304B9-2]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT2G38010

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CP002685 Genomic DNA Translation: AEC09477.1
CP002685 Genomic DNA Translation: AEC09478.1
PIRiH84799
RefSeqiNP_181337.2, NM_129358.3 [Q304B9-1]
NP_973628.1, NM_201899.2 [Q304B9-2]

3D structure databases

SMRiQ304B9
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi3723, 1 interactor
STRINGi3702.AT2G38010.2

PTM databases

MetOSiteiQ304B9

Proteomic databases

PaxDbiQ304B9
PRIDEiQ304B9
ProteomicsDBi251251 [Q304B9-1]

Genome annotation databases

EnsemblPlantsiAT2G38010.1; AT2G38010.1; AT2G38010 [Q304B9-1]
AT2G38010.2; AT2G38010.2; AT2G38010 [Q304B9-2]
GeneIDi818379
GrameneiAT2G38010.1; AT2G38010.1; AT2G38010 [Q304B9-1]
AT2G38010.2; AT2G38010.2; AT2G38010 [Q304B9-2]
KEGGiath:AT2G38010

Organism-specific databases

AraportiAT2G38010
TAIRilocus:2065685, AT2G38010

Phylogenomic databases

eggNOGiKOG2232, Eukaryota
HOGENOMiCLU_011300_2_0_1
InParanoidiQ304B9
OrthoDBi967085at2759
PhylomeDBiQ304B9

Enzyme and pathway databases

BioCyciARA:AT2G38010-MONOMER

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q304B9

Gene expression databases

ExpressionAtlasiQ304B9, baseline and differential
GenevisibleiQ304B9, AT

Family and domain databases

Gene3Di2.60.40.2300, 1 hit
InterProiView protein in InterPro
IPR006823, Ceramidase_alk
IPR038445, NCDase_C_sf
IPR031331, NEUT/ALK_ceramidase_C
IPR031329, NEUT/ALK_ceramidase_N
PANTHERiPTHR12670, PTHR12670, 1 hit
PfamiView protein in Pfam
PF04734, Ceramidase_alk, 1 hit
PF17048, Ceramidse_alk_C, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNCER2_ARATH
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q304B9
Secondary accession number(s): F4IRY2, Q3EBK8, Q7XJQ9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: December 6, 2005
Last modified: December 2, 2020
This is version 101 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again