Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein archease

Gene

ZBTB8OS

Organism
Bos taurus (Bovine)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Component of the tRNA-splicing ligase complex required to facilitate the enzymatic turnover of catalytic subunit RTCB. Together with DDX1, acts by facilitating the guanylylation of RTCB, a key intermediate step in tRNA ligation (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi39CalciumBy similarity1
Metal bindingi166CalciumBy similarity1
Metal bindingi167Calcium; via carboxylateBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processtRNA processing
LigandCalcium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protein archease
Alternative name(s):
Protein ZBTB8OS
Gene namesi
Name:ZBTB8OS
Synonyms:ARCH
OrganismiBos taurus (Bovine)
Taxonomic identifieri9913 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
Proteomesi
  • UP000009136 Componenti: Chromosome 2

Organism-specific databases

VGNCiVGNC:53571 ZBTB8OS

Subcellular locationi

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00002859492 – 167Protein archeaseAdd BLAST166

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

PaxDbiQ2YDE7
PRIDEiQ2YDE7

Expressioni

Gene expression databases

BgeeiENSBTAG00000027159 Expressed in 10 organ(s), highest expression level in testis

Interactioni

Subunit structurei

Component of the tRNA-splicing ligase complex.By similarity

Protein-protein interaction databases

STRINGi9913.ENSBTAP00000038735

Structurei

3D structure databases

ProteinModelPortaliQ2YDE7
SMRiQ2YDE7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the archease family.Curated

Phylogenomic databases

eggNOGiKOG4528 Eukaryota
COG1371 LUCA
GeneTreeiENSGT00390000003245
HOGENOMiHOG000229617
HOVERGENiHBG104905
InParanoidiQ2YDE7
OMAiYSAMQIH
OrthoDBiEOG091G0QBN
TreeFamiTF105957

Family and domain databases

Gene3Di3.55.10.10, 1 hit
InterProiView protein in InterPro
IPR002804 Archease
IPR023572 Archease_dom
IPR036820 Archease_dom_sf
PANTHERiPTHR12682 PTHR12682, 1 hit
PfamiView protein in Pfam
PF01951 Archease, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD012969 PD012969, 1 hit
SUPFAMiSSF69819 SSF69819, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q2YDE7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALEGEDVRD YNLTEEQKAI KAKYPPVSRK YEYLDHTADV QLHAWGDTLE
60 70 80 90 100
EAFEQCAMAM FGYMTDTGTV EPLQTIEVET QGDDLQSLLF HFLDEWLYKF
110 120 130 140 150
SADEFFIPRE VKVLNIDQRN FKIRSIGWGE EFSLSKHPQG TEVKAITYSA
160
MQVYNEEKPE VFVIIDI
Length:167
Mass (Da):19,432
Last modified:May 1, 2007 - v2
Checksum:i124DF476591C13E1
GO
Isoform 2 (identifier: Q2YDE7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     140-167: GTEVKAITYSAMQVYNEEKPEVFVIIDI → MPAAAAAASRFSRVRLCVTPYTAAHQAPPSLGFSRELKSKQ

Note: No experimental confirmation available.
Show »
Length:180
Mass (Da):20,618
Checksum:iE64914D20947BE6D
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_024925140 – 167GTEVK…VIIDI → MPAAAAAASRFSRVRLCVTP YTAAHQAPPSLGFSRELKSK Q in isoform 2. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC110257 mRNA Translation: AAI10258.1
EE251558 mRNA No translation available.
RefSeqiNP_001069756.1, NM_001076288.2 [Q2YDE7-2]
XP_005203056.1, XM_005202999.2 [Q2YDE7-1]
UniGeneiBt.21377

Genome annotation databases

EnsembliENSBTAT00000038929; ENSBTAP00000038735; ENSBTAG00000027159 [Q2YDE7-2]
ENSBTAT00000038930; ENSBTAP00000038736; ENSBTAG00000027159 [Q2YDE7-1]
GeneIDi613795
KEGGibta:613795

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC110257 mRNA Translation: AAI10258.1
EE251558 mRNA No translation available.
RefSeqiNP_001069756.1, NM_001076288.2 [Q2YDE7-2]
XP_005203056.1, XM_005202999.2 [Q2YDE7-1]
UniGeneiBt.21377

3D structure databases

ProteinModelPortaliQ2YDE7
SMRiQ2YDE7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9913.ENSBTAP00000038735

Proteomic databases

PaxDbiQ2YDE7
PRIDEiQ2YDE7

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSBTAT00000038929; ENSBTAP00000038735; ENSBTAG00000027159 [Q2YDE7-2]
ENSBTAT00000038930; ENSBTAP00000038736; ENSBTAG00000027159 [Q2YDE7-1]
GeneIDi613795
KEGGibta:613795

Organism-specific databases

CTDi339487
VGNCiVGNC:53571 ZBTB8OS

Phylogenomic databases

eggNOGiKOG4528 Eukaryota
COG1371 LUCA
GeneTreeiENSGT00390000003245
HOGENOMiHOG000229617
HOVERGENiHBG104905
InParanoidiQ2YDE7
OMAiYSAMQIH
OrthoDBiEOG091G0QBN
TreeFamiTF105957

Gene expression databases

BgeeiENSBTAG00000027159 Expressed in 10 organ(s), highest expression level in testis

Family and domain databases

Gene3Di3.55.10.10, 1 hit
InterProiView protein in InterPro
IPR002804 Archease
IPR023572 Archease_dom
IPR036820 Archease_dom_sf
PANTHERiPTHR12682 PTHR12682, 1 hit
PfamiView protein in Pfam
PF01951 Archease, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD012969 PD012969, 1 hit
SUPFAMiSSF69819 SSF69819, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiARCH_BOVIN
AccessioniPrimary (citable) accession number: Q2YDE7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: May 1, 2007
Last modified: September 12, 2018
This is version 75 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again