Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 123 (16 Oct 2019)
Sequence version 1 (20 Dec 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Electroneutral sodium bicarbonate exchanger 1

Gene

SLC4A8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Mediates electroneutral sodium- and carbonate-dependent chloride-HCO3- exchange with a Na+:HCO3- stoichiometry of 2:1. Plays a major role in pH regulation in neurons. May be involved in cell pH regulation by transporting HCO3- from blood to cell. Enhanced expression in severe acid stress could be important for cell survival by mediating the influx of HCO3- into the cells. Also mediates lithium-dependent HCO3- cotransport. May be regulated by osmolarity.2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Activity is inhibited by 4,4'-Di-isothiocyanatostilbene-2,2'-disulfonic acid (DIDS - an inhibitor of several anion channels and transporters).

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAnion exchange, Antiport, Ion transport, Sodium transport, Transport
LigandSodium

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-425381 Bicarbonate transporters

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.31.2.4 the anion exchanger (ae) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Electroneutral sodium bicarbonate exchanger 1
Alternative name(s):
Electroneutral Na(+)-driven Cl-HCO3 exchanger
Solute carrier family 4 member 8
k-NBC3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC4A8Imported
Synonyms:KIAA0739, NBCImported, NBC31 Publication, NDCBE11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11034 SLC4A8

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605024 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q2Y0W8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 478ExtracellularSequence analysisAdd BLAST478
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei479 – 499HelicalSequence analysisAdd BLAST21
Topological domaini500 – 523CytoplasmicSequence analysisAdd BLAST24
Transmembranei524 – 544HelicalSequence analysisAdd BLAST21
Topological domaini545 – 565ExtracellularSequence analysisAdd BLAST21
Transmembranei566 – 586HelicalSequence analysisAdd BLAST21
Topological domaini587 – 595CytoplasmicSequence analysis9
Transmembranei596 – 616HelicalSequence analysisAdd BLAST21
Topological domaini617 – 687ExtracellularSequence analysisAdd BLAST71
Transmembranei688 – 708HelicalSequence analysisAdd BLAST21
Topological domaini709 – 731CytoplasmicSequence analysisAdd BLAST23
Transmembranei732 – 752HelicalSequence analysisAdd BLAST21
Topological domaini753 – 778ExtracellularSequence analysisAdd BLAST26
Transmembranei779 – 799HelicalSequence analysisAdd BLAST21
Topological domaini800 – 824CytoplasmicSequence analysisAdd BLAST25
Transmembranei825 – 845HelicalSequence analysisAdd BLAST21
Topological domaini846 – 881ExtracellularSequence analysisAdd BLAST36
Transmembranei882 – 902HelicalSequence analysisAdd BLAST21
Topological domaini903 – 904CytoplasmicSequence analysis2
Transmembranei905 – 925HelicalSequence analysisAdd BLAST21
Topological domaini926 – 962ExtracellularSequence analysisAdd BLAST37
Transmembranei963 – 983HelicalSequence analysisAdd BLAST21
Topological domaini984 – 1093CytoplasmicSequence analysisAdd BLAST110

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9498

Open Targets

More...
OpenTargetsi
ENSG00000050438

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35900

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q2Y0W8

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB01390 Sodium bicarbonate

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLC4A8

Domain mapping of disease mutations (DMDM)

More...
DMDMi
121942008

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003289221 – 1093Electroneutral sodium bicarbonate exchanger 1Add BLAST1093

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi636 ↔ 638By similarity
Disulfide bondi672 ↔ 684By similarity

Keywords - PTMi

Disulfide bond

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q2Y0W8

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q2Y0W8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q2Y0W8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q2Y0W8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q2Y0W8

PeptideAtlas

More...
PeptideAtlasi
Q2Y0W8

PRoteomics IDEntifications database

More...
PRIDEi
Q2Y0W8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
16963
24921
61540 [Q2Y0W8-1]
61541 [Q2Y0W8-2]
61542 [Q2Y0W8-3]
61543 [Q2Y0W8-4]
61544 [Q2Y0W8-5]
61545 [Q2Y0W8-6]
61546 [Q2Y0W8-7]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q2Y0W8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q2Y0W8

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q2Y0W8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the pyramidal cells of the hippocampus (at protein level). Highly expressed in all major regions of the brain, spinal column and in testis, and moderate levels in trachea, thyroid and medulla region of kidney. Low expression levels observed in pancreas and kidney cortex.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000050438 Expressed in 183 organ(s), highest expression level in corpus callosum

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q2Y0W8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA031536

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114877, 33 interactors

Protein interaction database and analysis system

More...
IntActi
Q2Y0W8, 30 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000405812

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11093
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q2Y0W8

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1010 – 1036Sequence analysisAdd BLAST27

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the anion exchanger (TC 2.A.31) family. [View classification]Sequence analysis

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1172 Eukaryota
ENOG410XPHD LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157422

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000280684

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q2Y0W8

KEGG Orthology (KO)

More...
KOi
K13859

Identification of Orthologs from Complete Genome Data

More...
OMAi
VTTEVHW

Database of Orthologous Groups

More...
OrthoDBi
265068at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q2Y0W8

TreeFam database of animal gene trees

More...
TreeFami
TF313630

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.930.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013769 Band3_cytoplasmic_dom
IPR011531 HCO3_transpt_C
IPR003020 HCO3_transpt_euk
IPR003024 Na/HCO3_transpt
IPR016152 PTrfase/Anion_transptr

The PANTHER Classification System

More...
PANTHERi
PTHR11453 PTHR11453, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07565 Band_3_cyto, 1 hit
PF00955 HCO3_cotransp, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01231 HCO3TRNSPORT
PR01232 NAHCO3TRSPRT

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55804 SSF55804, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00834 ae, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 11 Publication (identifier: Q2Y0W8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPAAGSNEPD GVLSYQRPDE EAVVDQGGTS TILNIHYEKE ELEGHRTLYV
60 70 80 90 100
GVRMPLGRQS HRHHRTHGQK HRRRGRGKGA SQGEEGLEAL AHDTPSQRVQ
110 120 130 140 150
FILGTEEDEE HVPHELFTEL DEICMKEGED AEWKETARWL KFEEDVEDGG
160 170 180 190 200
ERWSKPYVAT LSLHSLFELR SCLINGTVLL DMHANSIEEI SDLILDQQEL
210 220 230 240 250
SSDLNDSMRV KVREALLKKH HHQNEKKRNN LIPIVRSFAE VGKKQSDPHL
260 270 280 290 300
MDKHGQTVSP QSVPTTNLEV KNGVNCEHSP VDLSKVDLHF MKKIPTGAEA
310 320 330 340 350
SNVLVGEVDI LDRPIVAFVR LSPAVLLSGL TEVPIPTRFL FILLGPVGKG
360 370 380 390 400
QQYHEIGRSM ATIMTDEIFH DVAYKAKERD DLLAGIDEFL DQVTVLPPGE
410 420 430 440 450
WDPSIRIEPP KNVPSQEKRK MPGVPNGNVC HIEQEPHGGH SGPELQRTGR
460 470 480 490 500
LFGGLVLDIK RKAPWYWSDY RDALSLQCLA SFLFLYCACM SPVITFGGLL
510 520 530 540 550
GEATEGRISA IESLFGASMT GIAYSLFAGQ ALTILGSTGP VLVFEKILFK
560 570 580 590 600
FCKDYALSYL SLRACIGLWT AFLCIVLVAT DASSLVCYIT RFTEEAFASL
610 620 630 640 650
ICIIFIYEAI EKLIHLAETY PIHMHSQLDH LSLYYCRCTL PENPNNHTLQ
660 670 680 690 700
YWKDHNIVTA EVHWANLTVS ECQEMHGEFM GSACGHHGPY TPDVLFWSCI
710 720 730 740 750
LFFTTFILSS TLKTFKTSRY FPTRVRSMVS DFAVFLTIFT MVIIDFLIGV
760 770 780 790 800
PSPKLQVPSV FKPTRDDRGW IINPIGPNPW WTVIAAIIPA LLCTILIFMD
810 820 830 840 850
QQITAVIINR KEHKLKKGCG YHLDLLMVAI MLGVCSIMGL PWFVAATVLS
860 870 880 890 900
ITHVNSLKLE SECSAPGEQP KFLGIREQRV TGLMIFVLMG CSVFMTAILK
910 920 930 940 950
FIPMPVLYGV FLYMGVSSLQ GIQFFDRLKL FGMPAKHQPD FIYLRHVPLR
960 970 980 990 1000
KVHLFTLIQL TCLVLLWVIK ASPAAIVFPM MVLALVFVRK VMDLCFSKRE
1010 1020 1030 1040 1050
LSWLDDLMPE SKKKKLDDAK KKAKEEEEAE KMLEIGGDKF PLESRKLLSS
1060 1070 1080 1090
PGKNISCRCD PSEINISDEM PKTTVWKALS MNSGNAKEKS LFN
Length:1,093
Mass (Da):122,938
Last modified:December 20, 2005 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDDF9D0BC3CBD1A06
GO
Isoform 21 Publication (identifier: Q2Y0W8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: MPAAGSNEPDGVLSYQ → MFNKNNSNKLRSTPRYRRGDPGYLNFTELGPLKPEQKDQWSQH
     1028-1093: EAEKMLEIGG...GNAKEKSLFN → VIVLAPTVYLGASNYRT

Note: No experimental confirmation available.Curated
Show »
Length:1,071
Mass (Da):120,987
Checksum:i6CF28C557074A1EE
GO
Isoform 31 Publication (identifier: Q2Y0W8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1028-1093: EAEKMLEIGG...GNAKEKSLFN → VIVLAPTVYLGASNYRT

Note: May be due to an intron retention.
Show »
Length:1,044
Mass (Da):117,473
Checksum:i083CF203D4D7FB55
GO
Isoform 41 Publication (identifier: Q2Y0W8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.
     1028-1093: EAEKMLEIGG...GNAKEKSLFN → VIVLAPTVYLGASNYRT

Note: May be due to an intron retention.
Show »
Length:991
Mass (Da):111,661
Checksum:i41DFC25D0B88F845
GO
Isoform 51 Publication (identifier: Q2Y0W8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.

Show »
Length:1,040
Mass (Da):117,126
Checksum:iA9CB5DD413DCDED7
GO
Isoform 61 Publication (identifier: Q2Y0W8-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     671-691: ECQEMHGEFMGSACGHHGPYT → VSLGAARCPSIVTTGLGGTSK
     692-1093: Missing.

Show »
Length:691
Mass (Da):77,094
Checksum:iEACAA9A36A17394B
GO
Isoform 7 (identifier: Q2Y0W8-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.
     725-800: VRSMVSDFAV...LLCTILIFMD → MESCSVAWLE...RPPKMLGLQA
     801-1093: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:747
Mass (Da):83,968
Checksum:iB02294FA3EB6A40E
GO
Isoform 8 (identifier: Q2Y0W8-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: Missing.
     671-691: ECQEMHGEFMGSACGHHGPYT → VSLGAARCPSIVTTGLGGTSK
     692-1093: Missing.

Note: No experimental confirmation available.
Show »
Length:638
Mass (Da):71,283
Checksum:iB8605D6EB82E7098
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA34459 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAD38576 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti482F → L in BAG58292 (PubMed:14702039).Curated1
Sequence conflicti1008M → T in AAC82380 (PubMed:11133997).Curated1
Isoform 7 (identifier: Q2Y0W8-7)
Sequence conflicti707Q → R in CAD38576 (PubMed:17974005).Curated1
Sequence conflicti716R → G in CAD38576 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_048351312D → A. Corresponds to variant dbSNP:rs35966334Ensembl.1
Natural variantiVAR_048352898I → V. Corresponds to variant dbSNP:rs12318785Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0527591 – 53Missing in isoform 4, isoform 5, isoform 7 and isoform 8. 3 PublicationsAdd BLAST53
Alternative sequenceiVSP_0527601 – 16MPAAG…VLSYQ → MFNKNNSNKLRSTPRYRRGD PGYLNFTELGPLKPEQKDQW SQH in isoform 2. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_052761671 – 691ECQEM…HGPYT → VSLGAARCPSIVTTGLGGTS K in isoform 6 and isoform 8. 2 PublicationsAdd BLAST21
Alternative sequenceiVSP_052762692 – 1093Missing in isoform 6 and isoform 8. 2 PublicationsAdd BLAST402
Alternative sequenceiVSP_052763725 – 800VRSMV…LIFMD → MESCSVAWLECGGVILAHCN LRLLPSSWDYRHAPPQPANF CIFSRDGVSPCWPGWSQSLD LVICLPRPPKMLGLQA in isoform 7. 1 PublicationAdd BLAST76
Alternative sequenceiVSP_052764801 – 1093Missing in isoform 7. 1 PublicationAdd BLAST293
Alternative sequenceiVSP_0527651028 – 1093EAEKM…KSLFN → VIVLAPTVYLGASNYRT in isoform 2, isoform 3 and isoform 4. 3 PublicationsAdd BLAST66

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF069512 mRNA Translation: AAC82380.1
DQ063579 mRNA Translation: AAY79176.1
DQ975204 mRNA Translation: ABJ09587.1
DQ996537 mRNA Translation: ABJ91576.1
DQ996398 mRNA Translation: ABJ91577.1
AB018282 mRNA Translation: BAA34459.1 Different initiation.
AK295315 mRNA Translation: BAG58292.1
AL831915 mRNA Translation: CAD38576.2 Different initiation.
AC025097 Genomic DNA No translation available.
AC046135 Genomic DNA No translation available.
AC107031 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW58192.1
BC025994 mRNA Translation: AAH25994.1
AF107099 mRNA Translation: AAD52981.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44890.1 [Q2Y0W8-1]
CCDS58232.1 [Q2Y0W8-7]
CCDS58233.1 [Q2Y0W8-8]
CCDS73470.1 [Q2Y0W8-5]

NCBI Reference Sequences

More...
RefSeqi
NP_001035049.1, NM_001039960.2 [Q2Y0W8-1]
NP_001245330.1, NM_001258401.2 [Q2Y0W8-5]
NP_001245331.1, NM_001258402.1 [Q2Y0W8-6]
NP_001245332.1, NM_001258403.1 [Q2Y0W8-7]
NP_001254544.1, NM_001267615.1 [Q2Y0W8-8]
XP_016875730.1, XM_017020241.1 [Q2Y0W8-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000358657; ENSP00000351483; ENSG00000050438 [Q2Y0W8-5]
ENST00000453097; ENSP00000405812; ENSG00000050438 [Q2Y0W8-1]
ENST00000514353; ENSP00000442561; ENSG00000050438 [Q2Y0W8-7]
ENST00000535225; ENSP00000441520; ENSG00000050438 [Q2Y0W8-8]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9498

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9498

UCSC genome browser

More...
UCSCi
uc001rys.3 human [Q2Y0W8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF069512 mRNA Translation: AAC82380.1
DQ063579 mRNA Translation: AAY79176.1
DQ975204 mRNA Translation: ABJ09587.1
DQ996537 mRNA Translation: ABJ91576.1
DQ996398 mRNA Translation: ABJ91577.1
AB018282 mRNA Translation: BAA34459.1 Different initiation.
AK295315 mRNA Translation: BAG58292.1
AL831915 mRNA Translation: CAD38576.2 Different initiation.
AC025097 Genomic DNA No translation available.
AC046135 Genomic DNA No translation available.
AC107031 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW58192.1
BC025994 mRNA Translation: AAH25994.1
AF107099 mRNA Translation: AAD52981.1
CCDSiCCDS44890.1 [Q2Y0W8-1]
CCDS58232.1 [Q2Y0W8-7]
CCDS58233.1 [Q2Y0W8-8]
CCDS73470.1 [Q2Y0W8-5]
RefSeqiNP_001035049.1, NM_001039960.2 [Q2Y0W8-1]
NP_001245330.1, NM_001258401.2 [Q2Y0W8-5]
NP_001245331.1, NM_001258402.1 [Q2Y0W8-6]
NP_001245332.1, NM_001258403.1 [Q2Y0W8-7]
NP_001254544.1, NM_001267615.1 [Q2Y0W8-8]
XP_016875730.1, XM_017020241.1 [Q2Y0W8-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5JHOX-ray2.80A/B54-397[»]
SMRiQ2Y0W8
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi114877, 33 interactors
IntActiQ2Y0W8, 30 interactors
STRINGi9606.ENSP00000405812

Chemistry databases

DrugBankiDB01390 Sodium bicarbonate

Protein family/group databases

TCDBi2.A.31.2.4 the anion exchanger (ae) family

PTM databases

iPTMnetiQ2Y0W8
PhosphoSitePlusiQ2Y0W8
SwissPalmiQ2Y0W8

Polymorphism and mutation databases

BioMutaiSLC4A8
DMDMi121942008

Proteomic databases

EPDiQ2Y0W8
jPOSTiQ2Y0W8
MassIVEiQ2Y0W8
MaxQBiQ2Y0W8
PaxDbiQ2Y0W8
PeptideAtlasiQ2Y0W8
PRIDEiQ2Y0W8
ProteomicsDBi16963
24921
61540 [Q2Y0W8-1]
61541 [Q2Y0W8-2]
61542 [Q2Y0W8-3]
61543 [Q2Y0W8-4]
61544 [Q2Y0W8-5]
61545 [Q2Y0W8-6]
61546 [Q2Y0W8-7]

Genome annotation databases

EnsembliENST00000358657; ENSP00000351483; ENSG00000050438 [Q2Y0W8-5]
ENST00000453097; ENSP00000405812; ENSG00000050438 [Q2Y0W8-1]
ENST00000514353; ENSP00000442561; ENSG00000050438 [Q2Y0W8-7]
ENST00000535225; ENSP00000441520; ENSG00000050438 [Q2Y0W8-8]
GeneIDi9498
KEGGihsa:9498
UCSCiuc001rys.3 human [Q2Y0W8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9498
DisGeNETi9498

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLC4A8
HGNCiHGNC:11034 SLC4A8
HPAiHPA031536
MIMi605024 gene
neXtProtiNX_Q2Y0W8
OpenTargetsiENSG00000050438
PharmGKBiPA35900

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1172 Eukaryota
ENOG410XPHD LUCA
GeneTreeiENSGT00940000157422
HOGENOMiHOG000280684
InParanoidiQ2Y0W8
KOiK13859
OMAiVTTEVHW
OrthoDBi265068at2759
PhylomeDBiQ2Y0W8
TreeFamiTF313630

Enzyme and pathway databases

ReactomeiR-HSA-425381 Bicarbonate transporters

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SLC4A8 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SLC4A8

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9498
PharosiQ2Y0W8

Protein Ontology

More...
PROi
PR:Q2Y0W8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000050438 Expressed in 183 organ(s), highest expression level in corpus callosum
GenevisibleiQ2Y0W8 HS

Family and domain databases

Gene3Di3.40.930.10, 1 hit
InterProiView protein in InterPro
IPR013769 Band3_cytoplasmic_dom
IPR011531 HCO3_transpt_C
IPR003020 HCO3_transpt_euk
IPR003024 Na/HCO3_transpt
IPR016152 PTrfase/Anion_transptr
PANTHERiPTHR11453 PTHR11453, 1 hit
PfamiView protein in Pfam
PF07565 Band_3_cyto, 1 hit
PF00955 HCO3_cotransp, 1 hit
PRINTSiPR01231 HCO3TRNSPORT
PR01232 NAHCO3TRSPRT
SUPFAMiSSF55804 SSF55804, 1 hit
TIGRFAMsiTIGR00834 ae, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiS4A8_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q2Y0W8
Secondary accession number(s): A0MMZ1
, B4DHY0, E7EML0, F5GZ31, F5H7F5, O94843, O95233, Q004B4, Q8N3U2, Q8TC60, Q9UKX8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: December 20, 2005
Last modified: October 16, 2019
This is version 123 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again