Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MLX-interacting protein

Gene

Mlxip

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Binds DNA as a heterodimer with MLX and activates transcription. Binds to the canonical E box sequence 5'-CACGTG-3'. Plays a role in transcriptional activation of glycolytic target genes. Involved in glucose-responsive gene regulation.By similarity2 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, DNA-binding
Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
MLX-interacting protein
Alternative name(s):
Transcriptional activator MondoA
Gene namesi
Name:MlxipImported
Synonyms:MirImported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:2141183 Mlxip

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane, Mitochondrion, Mitochondrion outer membrane, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00002987642 – 917MLX-interacting proteinAdd BLAST916

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1
Modified residuei9PhosphoserineBy similarity1
Modified residuei33PhosphoserineBy similarity1
Modified residuei39PhosphoserineCombined sources1
Modified residuei667PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ2VPU4
PaxDbiQ2VPU4
PRIDEiQ2VPU4

PTM databases

iPTMnetiQ2VPU4
PhosphoSitePlusiQ2VPU4

Expressioni

Developmental stagei

Broadly expressed from 9.5 dpc to at least 15 dpc, with slightly elevated levels in the developing nervous system.1 Publication

Gene expression databases

CleanExiMM_MLXIP

Interactioni

Subunit structurei

Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a homodimer or a heterodimer with MLX.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi228948, 2 interactors
STRINGi10090.ENSMUSP00000064943

Structurei

3D structure databases

ProteinModelPortaliQ2VPU4
SMRiQ2VPU4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini717 – 767bHLHPROSITE-ProRule annotationAdd BLAST51

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni73 – 327Required for cytoplasmic localizationBy similarityAdd BLAST255
Regioni322 – 445Transactivation domain1 PublicationAdd BLAST124
Regioni767 – 788Leucine-zipperAdd BLAST22
Regioni830 – 879Mediates heterotypic interactions between MLXIP and MLX and is required for cytoplasmic localizationBy similarityAdd BLAST50

Phylogenomic databases

eggNOGiKOG3582 Eukaryota
ENOG410XTA5 LUCA
HOGENOMiHOG000113606
HOVERGENiHBG062003
InParanoidiQ2VPU4
KOiK09113
PhylomeDBiQ2VPU4

Family and domain databases

CDDicd00083 HLH, 1 hit
Gene3Di4.10.280.10, 1 hit
InterProiView protein in InterPro
IPR011598 bHLH_dom
IPR036638 HLH_DNA-bd_sf
IPR032648 MLXIP
PANTHERiPTHR15741:SF23 PTHR15741:SF23, 1 hit
PfamiView protein in Pfam
PF00010 HLH, 1 hit
SMARTiView protein in SMART
SM00353 HLH, 1 hit
SUPFAMiSSF47459 SSF47459, 1 hit
PROSITEiView protein in PROSITE
PS50888 BHLH, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q2VPU4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAADVFMCSP RRPRSRGRSV LLKPQVPEDD DDSDTDEPSP PPPSGVATSA
60 70 80 90 100
RAHASAAPLP PRAGPGREEP PRRQQIIHSG HFMVSSPHRE HPPKKGYDFD
110 120 130 140 150
TVNKQTCQTY SFGKTSSCHL SIDASLTKLF ECMTLAYSGK LVSPKWKNFK
160 170 180 190 200
GLKLQWRDKI RLNNAIWRAW YMQYLEKRRN PVCHFVTPLD GSVDVDEHRR
210 220 230 240 250
PEAITTEGKY WKSRIEIVIR EYHKWRTYFK KRLQQHKDED LSSLAQDDDM
260 270 280 290 300
LYWHKHGDGW KTPVPMEEDS LLDTDMLMSE FSDTLFSTLS SHQPVAWPNP
310 320 330 340 350
REIAHLGNAD MIQPGLIPLQ PNLDFMDTFE PFQDLFSSSR SIFGSMLPPP
360 370 380 390 400
SSLPAADPSS PPSQGNILPN TALPPASLPN SLITSSAAPS LDPTEGQGCE
410 420 430 440 450
RTSQTVDPFI QPADFGPSEP PLSVPQPFLP VFTMTLLSPG PAPAPVPTAL
460 470 480 490 500
PLVPSPAPTL NPPTPPAFLQ PQKFAGVSKS TPVITHTASA TLTHDASATT
510 520 530 540 550
FSQNQGLVIT AHHPTPSSSP CALALSPVPQ PPAVGPPQPH LTFIHPKPVS
560 570 580 590 600
LTGVRHKQPP KIVPAPKPEP VSLVLKNACI APAAFSGQPQ KVIMTSAPLK
610 620 630 640 650
REGILASTVS PSNVVIASAA ITRASGVTEF LSHSTSSQPS PVSRLFSPST
660 670 680 690 700
VQDSLVKGEQ VSLHGGSPQV PATGSSRDCP NSGQASPCPS EQSPSPQSPQ
710 720 730 740 750
NNCSGKSTDP KNVAALKNRQ KHISAEQKRR FNIRMGFNTL NSLISNNSKQ
760 770 780 790 800
TSHAITLQKT MEYITKLQQE RMQMQEEARR LREEIEELNT TIISCQQLLP
810 820 830 840 850
ATGVPVNCRQ LDHMRDMFDE YVKSRTLQNW KFWIFSMIIK PLFESFKGMV
860 870 880 890 900
STSSLEEFHR TALSWLDQHC SLPVLRPMVL STLRQLSTTT SILTDPSQLP
910
EQASEAVTRM GKRSGES
Length:917
Mass (Da):100,804
Last modified:January 10, 2006 - v1
Checksum:i2944C041E78F89FC
GO
Isoform 21 Publication (identifier: Q2VPU4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     583-614: AAFSGQPQKVIMTSAPLKREGILASTVSPSNV → GELVGGVVSQNCLGSNVSLSLRLYIGKNSLPT
     615-917: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:614
Mass (Da):67,085
Checksum:iB72C6C2905A8EA3E
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G5E8D8G5E8D8_MOUSE
MLX interacting protein, isoform CR...
Mlxip mCG_142189
917Annotation score:
F6UPM1F6UPM1_MOUSE
MLX-interacting protein
Mlxip
241Annotation score:
B2RQ56B2RQ56_MOUSE
MLX-interacting protein
Mlxip
614Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti179R → K in BAC33069 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_052505583 – 614AAFSG…SPSNV → GELVGGVVSQNCLGSNVSLS LRLYIGKNSLPT in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_052506615 – 917Missing in isoform 2. 1 PublicationAdd BLAST303

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY968204 mRNA Translation: AAY41069.1
AK047475 mRNA Translation: BAC33069.1
BC060733 mRNA Translation: AAH60733.1
BC067045 mRNA Translation: AAH67045.1
AF265663 mRNA Translation: AAL55724.1
CCDSiCCDS19662.1 [Q2VPU4-1]
CCDS39268.1 [Q2VPU4-2]
RefSeqiNP_598678.2, NM_133917.3
NP_808250.1, NM_177582.3
UniGeneiMm.83277

Genome annotation databases

GeneIDi208104
KEGGimmu:208104

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY968204 mRNA Translation: AAY41069.1
AK047475 mRNA Translation: BAC33069.1
BC060733 mRNA Translation: AAH60733.1
BC067045 mRNA Translation: AAH67045.1
AF265663 mRNA Translation: AAL55724.1
CCDSiCCDS19662.1 [Q2VPU4-1]
CCDS39268.1 [Q2VPU4-2]
RefSeqiNP_598678.2, NM_133917.3
NP_808250.1, NM_177582.3
UniGeneiMm.83277

3D structure databases

ProteinModelPortaliQ2VPU4
SMRiQ2VPU4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi228948, 2 interactors
STRINGi10090.ENSMUSP00000064943

PTM databases

iPTMnetiQ2VPU4
PhosphoSitePlusiQ2VPU4

Proteomic databases

MaxQBiQ2VPU4
PaxDbiQ2VPU4
PRIDEiQ2VPU4

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi208104
KEGGimmu:208104

Organism-specific databases

CTDi22877
MGIiMGI:2141183 Mlxip

Phylogenomic databases

eggNOGiKOG3582 Eukaryota
ENOG410XTA5 LUCA
HOGENOMiHOG000113606
HOVERGENiHBG062003
InParanoidiQ2VPU4
KOiK09113
PhylomeDBiQ2VPU4

Miscellaneous databases

PROiPR:Q2VPU4
SOURCEiSearch...

Gene expression databases

CleanExiMM_MLXIP

Family and domain databases

CDDicd00083 HLH, 1 hit
Gene3Di4.10.280.10, 1 hit
InterProiView protein in InterPro
IPR011598 bHLH_dom
IPR036638 HLH_DNA-bd_sf
IPR032648 MLXIP
PANTHERiPTHR15741:SF23 PTHR15741:SF23, 1 hit
PfamiView protein in Pfam
PF00010 HLH, 1 hit
SMARTiView protein in SMART
SM00353 HLH, 1 hit
SUPFAMiSSF47459 SSF47459, 1 hit
PROSITEiView protein in PROSITE
PS50888 BHLH, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMLXIP_MOUSE
AccessioniPrimary (citable) accession number: Q2VPU4
Secondary accession number(s): Q6NXJ4
, Q6P9J8, Q8C8C6, Q8VI53
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: January 10, 2006
Last modified: November 7, 2018
This is version 100 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again