Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 109 (03 Jul 2019)
Sequence version 2 (27 Jul 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Scavenger receptor cysteine-rich type 1 protein M130

Gene

Cd163

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1 (By similarity).By similarity
After shedding, the soluble form (sCD163) may play an anti-inflammatory role.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAcute phase, Inflammatory response

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-2168880 Scavenging of heme from plasma

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Scavenger receptor cysteine-rich type 1 protein M130
Alternative name(s):
CD_antigen: CD163
Cleaved into the following chain:
Soluble CD163
Short name:
sCD163
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Cd163
Synonyms:M130
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2135946 Cd163

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini39 – 1045ExtracellularSequence analysisAdd BLAST1007
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1046 – 1066HelicalSequence analysisAdd BLAST21
Topological domaini1067 – 1121CytoplasmicSequence analysisAdd BLAST55

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 38Sequence analysisAdd BLAST38
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000023894039 – 1121Scavenger receptor cysteine-rich type 1 protein M130Add BLAST1083
ChainiPRO_000023894139 – ?Soluble CD163

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi75 ↔ 139PROSITE-ProRule annotation
Disulfide bondi88 ↔ 149PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi104N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi119 ↔ 129PROSITE-ProRule annotation
Glycosylationi138N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi183 ↔ 247PROSITE-ProRule annotation
Disulfide bondi196 ↔ 257PROSITE-ProRule annotation
Disulfide bondi227 ↔ 237PROSITE-ProRule annotation
Disulfide bondi290 ↔ 354PROSITE-ProRule annotation
Disulfide bondi303 ↔ 364PROSITE-ProRule annotation
Disulfide bondi334 ↔ 344PROSITE-ProRule annotation
Disulfide bondi397 ↔ 461PROSITE-ProRule annotation
Disulfide bondi410 ↔ 471PROSITE-ProRule annotation
Disulfide bondi441 ↔ 451PROSITE-ProRule annotation
Disulfide bondi502 ↔ 566PROSITE-ProRule annotation
Disulfide bondi515 ↔ 576PROSITE-ProRule annotation
Disulfide bondi546 ↔ 556PROSITE-ProRule annotation
Disulfide bondi607 ↔ 671PROSITE-ProRule annotation
Disulfide bondi620 ↔ 681PROSITE-ProRule annotation
Disulfide bondi651 ↔ 661PROSITE-ProRule annotation
Disulfide bondi744 ↔ 808PROSITE-ProRule annotation
Disulfide bondi757 ↔ 818PROSITE-ProRule annotation
Disulfide bondi788 ↔ 798PROSITE-ProRule annotation
Disulfide bondi864 ↔ 926PROSITE-ProRule annotation
Disulfide bondi895 ↔ 905PROSITE-ProRule annotation
Disulfide bondi955 ↔ 1019PROSITE-ProRule annotation
Disulfide bondi968 ↔ 1029PROSITE-ProRule annotation
Disulfide bondi999 ↔ 1009PROSITE-ProRule annotation

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

A soluble form (sCD163) is produced by proteolytic shedding which can be induced by lipopolysaccharide, phorbol ester and Fc region of immunoglobulin gamma. This cleavage is dependent on protein kinase C and tyrosine kinases and can be blocked by protease inhibitors. The shedding is inhibited by the tissue inhibitor of metalloproteinase TIMP3, and thus probably induced by membrane-bound metalloproteinases ADAMs (By similarity).By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q2VLH6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q2VLH6

PRoteomics IDEntifications database

More...
PRIDEi
Q2VLH6

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
2428 [Q2VLH6-2]

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q2VLH6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q2VLH6

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q2VLH6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen and mesenteric lymph nodes.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Induced by antiinflammatory mediators such as glucocorticoids and IL10; suppressed by IL4.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000008845 Expressed in 124 organ(s), highest expression level in stroma of bone marrow

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q2VLH6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q2VLH6 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CSNK2B.

By similarity

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q2VLH6, 1 interactor

Molecular INTeraction database

More...
MINTi
Q2VLH6

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000108160

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q2VLH6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini50 – 150SRCR 1PROSITE-ProRule annotationAdd BLAST101
Domaini157 – 258SRCR 2PROSITE-ProRule annotationAdd BLAST102
Domaini265 – 365SRCR 3PROSITE-ProRule annotationAdd BLAST101
Domaini372 – 472SRCR 4PROSITE-ProRule annotationAdd BLAST101
Domaini477 – 577SRCR 5PROSITE-ProRule annotationAdd BLAST101
Domaini582 – 682SRCR 6PROSITE-ProRule annotationAdd BLAST101
Domaini719 – 819SRCR 7PROSITE-ProRule annotationAdd BLAST101
Domaini824 – 927SRCR 8PROSITE-ProRule annotationAdd BLAST104
Domaini930 – 1030SRCR 9PROSITE-ProRule annotationAdd BLAST101

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi1091 – 1094Internalization signal4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The SRCR domain 3 mediates calcium-sensitive interaction with hemoglobin/haptoglobin complexes.By similarity

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IHBC Eukaryota
ENOG410XQVR LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155987

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000290652

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q2VLH6

KEGG Orthology (KO)

More...
KOi
K06545

Identification of Orthologs from Complete Genome Data

More...
OMAi
VTCSAHR

Database of Orthologous Groups

More...
OrthoDBi
1095487at2759

TreeFam database of animal gene trees

More...
TreeFami
TF329295

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.10.250.10, 9 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001190 SRCR
IPR017448 SRCR-like_dom
IPR036772 SRCR-like_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00530 SRCR, 9 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00258 SPERACTRCPTR

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00202 SR, 9 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56487 SSF56487, 9 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00420 SRCR_1, 3 hits
PS50287 SRCR_2, 9 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q2VLH6-1) [UniParc]FASTAAdd to basket
Also known as: CD163v2

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGGHRMVLLG GAGSPGCKRF VHLGFFVVAV SSLLSASAVT NAPGEMKKEL
60 70 80 90 100
RLAGGENNCS GRVELKIHDK WGTVCSNGWS MNEVSVVCQQ LGCPTSIKAL
110 120 130 140 150
GWANSSAGSG YIWMDKVSCT GNESALWDCK HDGWGKHNCT HEKDAGVTCS
160 170 180 190 200
DGSNLEMRLV NSAGHRCLGR VEIKFQGKWG TVCDDNFSKD HASVICKQLG
210 220 230 240 250
CGSAISFSGS AKLGAGSGPI WLDDLACNGN ESALWDCKHR GWGKHNCDHA
260 270 280 290 300
EDVGVICLEG ADLSLRLVDG VSRCSGRLEV RFQGEWGTVC DDNWDLRDAS
310 320 330 340 350
VVCKQLGCPT AISAIGRVNA SEGSGQIWLD NISCEGHEAT LWECKHQEWG
360 370 380 390 400
KHYCHHREDA GVTCSDGADL ELRLVGGGSR CAGIVEVEIQ KLTGKMCSRG
410 420 430 440 450
WTLADADVVC RQLGCGSALQ TQAKIYSKTG ATNTWLFPGS CNGNETTFWQ
460 470 480 490 500
CKNWQWGGLS CDNFEEAKVT CSGHREPRLV GGEIPCSGRV EVKHGDVWGS
510 520 530 540 550
VCDFDLSLEA ASVVCRELQC GTVVSILGGA HFGEGSGQIW GEEFQCSGDE
560 570 580 590 600
SHLSLCSVAP PLDRTCTHSR DVSVVCSRYI DIRLAGGESS CEGRVELKTL
610 620 630 640 650
GAWGPLCSSH WDMEDAHVLC QQLKCGVAQS IPEGAHFGKG AGQVWSHMFH
660 670 680 690 700
CTGTEEHIGD CLMTALGAPT CSEGQVASVI CSGNQSQTLL PCSSLSPVQT
710 720 730 740 750
TSSTIPKESE VPCIASGQLR LVGGGGRCAG RVEVYHEGSW GTVCDDNWDM
760 770 780 790 800
TDANVVCKQL DCGVAINATG SAYFGEGAGA IWLDEVICTG KESHIWQCHS
810 820 830 840 850
HGWGRHNCRH KEDAGVICSE FMSLRLTNEA HKENCTGRLE VFYNGTWGSI
860 870 880 890 900
GSSNMSPTTV GVVCRQLGCA DNGTVKPIPS DKTPSRPMWV DRVQCPKGVD
910 920 930 940 950
TLWQCPSSPW KQRQASPSSQ ESWIICDNKI RLQEGHTDCS GRVEIWHKGS
960 970 980 990 1000
WGTVCDDSWD LNDAKVVCKQ LGCGQAVKAL KEAAFGPGTG PIWLNEIKCR
1010 1020 1030 1040 1050
GNESSLWDCP AKPWSHSDCG HKEDASIQCL PKMTSESHHG TGHPTLTALL
1060 1070 1080 1090 1100
VCGAILLVLL IVFLLWTLKR RQIQRLTVSS RGEVLIHQVQ YQEMDSKADD
1110 1120
LDLLKSSGVI QRHTEKENDN L
Length:1,121
Mass (Da):120,921
Last modified:July 27, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i553B1EF5ED5064BD
GO
Isoform 2 (identifier: Q2VLH6-2) [UniParc]FASTAAdd to basket
Also known as: CD163v3

The sequence of this isoform differs from the canonical sequence as follows:
     1108-1121: GVIQRHTEKENDNL → ENSNNSYDFNDDGLTSLSKYLPISGIKKGSFRGTLRRKMIIYNPLRLEFKKP

Show »
Length:1,159
Mass (Da):125,292
Checksum:iF7FFA963E4277CC1
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti492V → M in AAY99764 (Ref. 2) Curated1
Sequence conflicti735Y → C in AAK16065 (PubMed:11345593).Curated1
Sequence conflicti834N → S in AAY99763 (Ref. 2) Curated1
Sequence conflicti950S → F in AAY99763 (Ref. 2) Curated1
Sequence conflicti1072Q → R in AAK16065 (PubMed:11345593).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0190161108 – 1121GVIQR…ENDNL → ENSNNSYDFNDDGLTSLSKY LPISGIKKGSFRGTLRRKMI IYNPLRLEFKKP in isoform 2. 1 PublicationAdd BLAST14

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF274883 mRNA Translation: AAK16065.1
DQ058616 mRNA Translation: AAY99763.1
DQ058617 mRNA Translation: AAY99764.1
CH466523 Genomic DNA Translation: EDK99729.1
BC145793 mRNA Translation: AAI45794.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS20516.1 [Q2VLH6-1]
CCDS51905.1 [Q2VLH6-2]

NCBI Reference Sequences

More...
RefSeqi
NP_444324.2, NM_053094.2 [Q2VLH6-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000032234; ENSMUSP00000032234; ENSMUSG00000008845 [Q2VLH6-1]
ENSMUST00000112541; ENSMUSP00000108160; ENSMUSG00000008845 [Q2VLH6-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
93671

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:93671

UCSC genome browser

More...
UCSCi
uc009dqn.2 mouse [Q2VLH6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF274883 mRNA Translation: AAK16065.1
DQ058616 mRNA Translation: AAY99763.1
DQ058617 mRNA Translation: AAY99764.1
CH466523 Genomic DNA Translation: EDK99729.1
BC145793 mRNA Translation: AAI45794.1
CCDSiCCDS20516.1 [Q2VLH6-1]
CCDS51905.1 [Q2VLH6-2]
RefSeqiNP_444324.2, NM_053094.2 [Q2VLH6-1]

3D structure databases

SMRiQ2VLH6
ModBaseiSearch...

Protein-protein interaction databases

IntActiQ2VLH6, 1 interactor
MINTiQ2VLH6
STRINGi10090.ENSMUSP00000108160

PTM databases

GlyConnecti2428 [Q2VLH6-2]
iPTMnetiQ2VLH6
PhosphoSitePlusiQ2VLH6
SwissPalmiQ2VLH6

Proteomic databases

MaxQBiQ2VLH6
PaxDbiQ2VLH6
PRIDEiQ2VLH6

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000032234; ENSMUSP00000032234; ENSMUSG00000008845 [Q2VLH6-1]
ENSMUST00000112541; ENSMUSP00000108160; ENSMUSG00000008845 [Q2VLH6-2]
GeneIDi93671
KEGGimmu:93671
UCSCiuc009dqn.2 mouse [Q2VLH6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9332
MGIiMGI:2135946 Cd163

Phylogenomic databases

eggNOGiENOG410IHBC Eukaryota
ENOG410XQVR LUCA
GeneTreeiENSGT00940000155987
HOGENOMiHOG000290652
InParanoidiQ2VLH6
KOiK06545
OMAiVTCSAHR
OrthoDBi1095487at2759
TreeFamiTF329295

Enzyme and pathway databases

ReactomeiR-MMU-2168880 Scavenging of heme from plasma

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q2VLH6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000008845 Expressed in 124 organ(s), highest expression level in stroma of bone marrow
ExpressionAtlasiQ2VLH6 baseline and differential
GenevisibleiQ2VLH6 MM

Family and domain databases

Gene3Di3.10.250.10, 9 hits
InterProiView protein in InterPro
IPR001190 SRCR
IPR017448 SRCR-like_dom
IPR036772 SRCR-like_dom_sf
PfamiView protein in Pfam
PF00530 SRCR, 9 hits
PRINTSiPR00258 SPERACTRCPTR
SMARTiView protein in SMART
SM00202 SR, 9 hits
SUPFAMiSSF56487 SSF56487, 9 hits
PROSITEiView protein in PROSITE
PS00420 SRCR_1, 3 hits
PS50287 SRCR_2, 9 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiC163A_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q2VLH6
Secondary accession number(s): A6H691, Q2VLH5, Q99MX8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: July 27, 2011
Last modified: July 3, 2019
This is version 109 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again