Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 57 (11 Dec 2019)
Sequence version 1 (10 Jan 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Scavenger receptor cysteine-rich type 1 protein M130

Gene

CD163

Organism
Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1 (By similarity).By similarity
After shedding, the soluble form (sCD163) may play an anti-inflammatory role.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAcute phase, Inflammatory response

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Scavenger receptor cysteine-rich type 1 protein M130
Alternative name(s):
CD_antigen: CD163
Cleaved into the following chain:
Soluble CD163
Short name:
sCD163
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CD163
Synonyms:M130
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiChlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9534 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniCercopithecidaeCercopithecinaeChlorocebus

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini46 – 1046ExtracellularSequence analysisAdd BLAST1001
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1047 – 1067HelicalSequence analysisAdd BLAST21
Topological domaini1068 – 1151CytoplasmicSequence analysisAdd BLAST84

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 45Sequence analysisAdd BLAST45
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000023893646 – 1151Scavenger receptor cysteine-rich type 1 protein M130Add BLAST1106
ChainiPRO_000023893746 – ?Soluble CD163

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi76 ↔ 141PROSITE-ProRule annotation
Disulfide bondi89 ↔ 151PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi105N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi120 ↔ 130PROSITE-ProRule annotation
Glycosylationi140N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi184 ↔ 248PROSITE-ProRule annotation
Disulfide bondi197 ↔ 258PROSITE-ProRule annotation
Disulfide bondi228 ↔ 238PROSITE-ProRule annotation
Disulfide bondi291 ↔ 355PROSITE-ProRule annotation
Disulfide bondi304 ↔ 365PROSITE-ProRule annotation
Disulfide bondi335 ↔ 345PROSITE-ProRule annotation
Disulfide bondi398 ↔ 462PROSITE-ProRule annotation
Disulfide bondi411 ↔ 472PROSITE-ProRule annotation
Disulfide bondi442 ↔ 452PROSITE-ProRule annotation
Disulfide bondi503 ↔ 567PROSITE-ProRule annotation
Disulfide bondi516 ↔ 577PROSITE-ProRule annotation
Disulfide bondi547 ↔ 557PROSITE-ProRule annotation
Disulfide bondi608 ↔ 672PROSITE-ProRule annotation
Disulfide bondi621 ↔ 682PROSITE-ProRule annotation
Disulfide bondi652 ↔ 662PROSITE-ProRule annotation
Disulfide bondi744 ↔ 808PROSITE-ProRule annotation
Disulfide bondi757 ↔ 818PROSITE-ProRule annotation
Disulfide bondi788 ↔ 798PROSITE-ProRule annotation
Glycosylationi854N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi864 ↔ 925PROSITE-ProRule annotation
Disulfide bondi895 ↔ 905PROSITE-ProRule annotation
Disulfide bondi954 ↔ 1018PROSITE-ProRule annotation
Disulfide bondi967 ↔ 1028PROSITE-ProRule annotation
Disulfide bondi998 ↔ 1008PROSITE-ProRule annotation

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

A soluble form (sCD163) is produced by proteolytic shedding which can be induced by lipopolysaccharide, phorbol ester and Fc region of immunoglobulin gamma. This cleavage is dependent on protein kinase C and tyrosine kinases and can be blocked by protease inhibitors. The shedding is inhibited by the tissue inhibitor of metalloproteinase TIMP3, and thus probably induced by membrane-bound metalloproteinases ADAMs (By similarity).By similarity
Phosphorylated.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PRoteomics IDEntifications database

More...
PRIDEi
Q2VLG4

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CSNK2B.

By similarity

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q2VLG4

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini51 – 152SRCR 1PROSITE-ProRule annotationAdd BLAST102
Domaini159 – 259SRCR 2PROSITE-ProRule annotationAdd BLAST101
Domaini266 – 366SRCR 3PROSITE-ProRule annotationAdd BLAST101
Domaini373 – 473SRCR 4PROSITE-ProRule annotationAdd BLAST101
Domaini478 – 578SRCR 5PROSITE-ProRule annotationAdd BLAST101
Domaini583 – 683SRCR 6PROSITE-ProRule annotationAdd BLAST101
Domaini719 – 819SRCR 7PROSITE-ProRule annotationAdd BLAST101
Domaini824 – 926SRCR 8PROSITE-ProRule annotationAdd BLAST103
Domaini929 – 1029SRCR 9PROSITE-ProRule annotationAdd BLAST101

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi1091 – 1094Internalization signal4

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The SRCR domain 3 mediates calcium-sensitive interaction with hemoglobin/haptoglobin complexes.By similarity

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.10.250.10, 9 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001190 SRCR
IPR017448 SRCR-like_dom
IPR036772 SRCR-like_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00530 SRCR, 9 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00258 SPERACTRCPTR

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00202 SR, 9 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56487 SSF56487, 9 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00420 SRCR_1, 4 hits
PS50287 SRCR_2, 9 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q2VLG4-1) [UniParc]FASTAAdd to basket
Also known as: CD163v3, CD163v7

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSKLRMVLLE DSGSADVRRH FVNLSPFTIA VVLLLRACFV TSSLGGTTKE
60 70 80 90 100
LRLVDGENKC SGRVEVKIQE EWGTVCNNGW SMEAVSVICN QLGCPTAIKA
110 120 130 140 150
TGWANSSAGS GRIWMDHVSC RGNESALWDC KHDGWGKHSN CTHQQDAGVT
160 170 180 190 200
CSDGSDLEMR LTNGGNMCSG RIEIKFQGQW GTVCDDNFNI NHASVVCKQL
210 220 230 240 250
ECGSAVSFSG SANFGEGSGP IWFDDLICNG NESALWNCKH QGWGKHNCDH
260 270 280 290 300
AEDAGVICSK GADLSLRLVD GVTECSGRLE VRFQGEWGTI CDDGWDSHDA
310 320 330 340 350
AVACKQLGCP TAITAIGRVN ASEGFGHIWL DSVSCQGHEP AVWQCKHHEW
360 370 380 390 400
GKHYCNHNED AGVTCSDGSD LELRLRGGGS RCAGTVEVEI QRLLGKVCDR
410 420 430 440 450
GWGLKEADVV CRQLGCGSAL KTSYQVYSKI QATNMWLFLS SCNGNETSLW
460 470 480 490 500
DCKNWQWGGL TCDHYEEAKI TCSAHREPRL VGGDIPCSGR VEVKHGDTWG
510 520 530 540 550
SVCDSDFSLE AASVLCRELQ CGTVVSILGG AHFGEGNGQI WTEEFQCEGH
560 570 580 590 600
ESHLSLCPVA PRPEGTCSHS RDVGVVCSRY TEIRLVNGKT PCEGRVELKT
610 620 630 640 650
LNAWGSLCNS HWDIEDAHVL CQQLKCGVAL STPGGAHFGK GNGQVWRHMF
660 670 680 690 700
HCTGTEQHMG DCPVTALGAS LCPSGQVASV ICSGNQSQTL SSCNSSSLGP
710 720 730 740 750
TRPTIPEESA VACIESGQLR LVNGGGRCAG RVEIYHEGSW GTICDDSWDL
760 770 780 790 800
SDAHVVCRQL GCGEAINATG SAHFGEGTGP IWLDEMKCNG KESRIWQCHS
810 820 830 840 850
HGWGQQNCRH KEDAGVICSE FMSLRLTSEA SREACAGRLE VFYNGAWGSV
860 870 880 890 900
GRSNMSETTV GVVCRQLGCA DKGKINSASL DKAMSIPMWV DNVQCPKGPD
910 920 930 940 950
TLWQCPSSPW EKRLARPSEE TWITCDNKMR LQEGPTSCSG RVEIWHGGSW
960 970 980 990 1000
GTVCDDSWDL NDAQVVCQQL GCGPALKAFK EAEFGQGTGP IWLNEVKCKG
1010 1020 1030 1040 1050
NESSLWDCPA RRWGHSECGH KEDAAVNCTD ISTRKTPQKA TTGQSSLIAV
1060 1070 1080 1090 1100
GILGVVLLAI FVALFLTQKR RQRQRLTVSS RGENLVHQIQ YREMNSCLNA
1110 1120 1130 1140 1150
DDLDLMNSSE NSNESADFNA AELISVSKFL PISGMEKEAI LRHTEKENGN

L
Length:1,151
Mass (Da):124,873
Last modified:January 10, 2006 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i82F06AD79C12CE2D
GO
Isoform 2 (identifier: Q2VLG4-2) [UniParc]FASTAAdd to basket
Also known as: CD163v2, CD163v6

The sequence of this isoform differs from the canonical sequence as follows:
     1110-1151: ENSNESADFNAAELISVSKFLPISGMEKEAILRHTEKENGNL → GGHSEAH

Show »
Length:1,116
Mass (Da):120,933
Checksum:i26C592380D106768
GO
Isoform 3 (identifier: Q2VLG4-3) [UniParc]FASTAAdd to basket
Also known as: CD163v4, CD163v5

The sequence of this isoform differs from the canonical sequence as follows:
     1042-1076: Missing.
     1110-1151: ENSNESADFNAAELISVSKFLPISGMEKEAILRHTEKENGNL → GGHSEAH

Show »
Length:1,081
Mass (Da):117,084
Checksum:i0193DAB86655010E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti190I → V in AAY99770 (Ref. 1) Curated1
Sequence conflicti370D → G in AAY99767 (Ref. 1) Curated1
Sequence conflicti542T → A in AAY99770 (Ref. 1) Curated1
Sequence conflicti542T → A in AAY99771 (Ref. 1) Curated1
Sequence conflicti542T → A in AAY99772 (Ref. 1) Curated1
Sequence conflicti542T → A in AAZ50615 (Ref. 1) Curated1
Sequence conflicti693C → R in AAY99767 (Ref. 1) Curated1
Sequence conflicti877S → P in AAZ50615 (Ref. 1) Curated1
Sequence conflicti999K → E in AAY99767 (Ref. 1) Curated1
Sequence conflicti1030D → AQK in AAY99770 (Ref. 1) Curated1
Sequence conflicti1030D → AQK in AAY99771 (Ref. 1) Curated1
Sequence conflicti1030D → AQK in AAY99772 (Ref. 1) Curated1
Sequence conflicti1034R → H in AAY99770 (Ref. 1) Curated1
Sequence conflicti1034R → H in AAY99771 (Ref. 1) Curated1
Sequence conflicti1034R → H in AAY99772 (Ref. 1) Curated1
Sequence conflicti1034R → N in AAZ50615 (Ref. 1) Curated1
Sequence conflicti1044 – 1046QSS → RSF in AAY99771 (Ref. 1) Curated3
Sequence conflicti1046S → F in AAY99772 (Ref. 1) Curated1
Sequence conflicti1050V → F in AAY99771 (Ref. 1) Curated1
Sequence conflicti1050V → F in AAY99772 (Ref. 1) Curated1
Sequence conflicti1059A → V in AAZ50615 (Ref. 1) Curated1
Sequence conflicti1104D → N in AAY99769 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0190111042 – 1076Missing in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_0190121110 – 1151ENSNE…ENGNL → GGHSEAH in isoform 2 and isoform 3. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ060838 mRNA Translation: AAY99767.1
DQ060839 mRNA Translation: AAY99768.1
DQ060840 mRNA Translation: AAY99769.1
DQ060841 mRNA Translation: AAY99770.1
DQ060842 mRNA Translation: AAY99771.1
DQ060843 mRNA Translation: AAY99772.1
DQ067277 mRNA Translation: AAZ50615.1

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ060838 mRNA Translation: AAY99767.1
DQ060839 mRNA Translation: AAY99768.1
DQ060840 mRNA Translation: AAY99769.1
DQ060841 mRNA Translation: AAY99770.1
DQ060842 mRNA Translation: AAY99771.1
DQ060843 mRNA Translation: AAY99772.1
DQ067277 mRNA Translation: AAZ50615.1

3D structure databases

SMRiQ2VLG4
ModBaseiSearch...

Proteomic databases

PRIDEiQ2VLG4

Family and domain databases

Gene3Di3.10.250.10, 9 hits
InterProiView protein in InterPro
IPR001190 SRCR
IPR017448 SRCR-like_dom
IPR036772 SRCR-like_dom_sf
PfamiView protein in Pfam
PF00530 SRCR, 9 hits
PRINTSiPR00258 SPERACTRCPTR
SMARTiView protein in SMART
SM00202 SR, 9 hits
SUPFAMiSSF56487 SSF56487, 9 hits
PROSITEiView protein in PROSITE
PS00420 SRCR_1, 4 hits
PS50287 SRCR_2, 9 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiC163A_CHLAE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q2VLG4
Secondary accession number(s): Q2VL91
, Q2VLG0, Q2VLG1, Q2VLG2, Q2VLG3, Q2VLG5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: January 10, 2006
Last modified: December 11, 2019
This is version 57 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again