Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 119 (29 Sep 2021)
Sequence version 2 (22 Jul 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Eukaryotic translation initiation factor 2 subunit 3B

Gene

EIF2S3B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

As a subunit of eukaryotic initiation factor 2 (eIF-2), involved in the early steps of protein synthesis. In the presence of GTP, eIF-2 forms a ternary complex with initiator tRNA Met-tRNAi and then recruits the 40S ribosomal complex and initiation factors eIF-1, eIF-1A and eIF-3 to form the 43S pre-initiation complex (43S PIC), a step that determines the rate of protein translation. The 43S PIC binds to mRNA and scans downstream to the initiation codon, where it forms a 48S initiation complex by codon-anticodon base pairing. This leads to the displacement of eIF-1 to allow GTPase-activating protein (GAP) eIF-5-mediated hydrolysis of eIF2-bound GTP. Hydrolysis of GTP and release of Pi, which makes GTP hydrolysis irreversible, causes the release of the eIF-2-GDP binary complex from the 40S subunit, an event that is essential for the subsequent joining of the 60S ribosomal subunit to form an elongation-competent 80S ribosome. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must be exchanged with GTP by way of a reaction catalyzed by GDP-GTP exchange factor (GEF) eIF-2B (By similarity).

Along with its paralog on chromosome Y, may contribute to spermatogenesis up to the round spermatid stage (By similarity).

By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi51 – 56GTPBy similarity6
Nucleotide bindingi190 – 193GTPBy similarity4
Nucleotide bindingi225 – 227GTPBy similarity3

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Initiation factor
Biological processProtein biosynthesis
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q2VIR3

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Eukaryotic translation initiation factor 2 subunit 3BCurated (EC:3.6.5.3)
Alternative name(s):
Eukaryotic translation initiation factor 2 subunit gamma A
Short name:
eIF-2-gamma A1 Publication
Short name:
eIF-2gA
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:EIF2S3BImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:43863, EIF2S3B

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q2VIR3

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000180574

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000180574

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q2VIR3, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
EIF2S3L
ENSG00000180574

Domain mapping of disease mutations (DMDM)

More...
DMDMi
205830883

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003439412 – 472Eukaryotic translation initiation factor 2 subunit 3BAdd BLAST471

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineBy similarity1
Modified residuei16PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q2VIR3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q2VIR3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q2VIR3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q2VIR3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q2VIR3

PeptideAtlas

More...
PeptideAtlasi
Q2VIR3

PRoteomics IDEntifications database

More...
PRIDEi
Q2VIR3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
30052
61512 [Q2VIR3-1]
61513 [Q2VIR3-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q2VIR3

MetOSite database of methionine sulfoxide sites

More...
MetOSitei
Q2VIR3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q2VIR3

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q2VIR3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Specifically expressed in testis at the mRNA level.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000180574, Expressed in leukocyte and 81 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q2VIR3, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000180574, Tissue enhanced (testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The eukaryotic translation initiation factor 2 complex/eIF2 is a heterotrimer composed of an alpha, a beta and a gamma subunit.

By similarity

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q2VIR3, 7 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000445077

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q2VIR3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini39 – 248tr-type GPROSITE-ProRule annotationAdd BLAST210

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni48 – 55G1PROSITE-ProRule annotation8
Regioni76 – 80G2PROSITE-ProRule annotation5
Regioni134 – 137G3PROSITE-ProRule annotation4
Regioni190 – 193G4PROSITE-ProRule annotation4
Regioni225 – 227G5PROSITE-ProRule annotation3

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0466, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00550000074801

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_027154_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q2VIR3

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q2VIR3

TreeFam database of animal gene trees

More...
TreeFami
TF101513

Family and domain databases

Conserved Domains Database

More...
CDDi
cd01888, eIF2_gamma, 1 hit
cd03688, eIF2_gamma_II, 1 hit
cd15490, eIF2_gamma_III, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.300, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004161, EFTu-like_2
IPR015256, eIF2g_C
IPR044127, eIF2g_dom_2
IPR044128, eIF2g_GTP-bd
IPR027417, P-loop_NTPase
IPR000795, T_Tr_GTP-bd_dom
IPR009000, Transl_B-barrel_sf
IPR009001, Transl_elong_EF1A/Init_IF2_C

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF09173, eIF2_C, 1 hit
PF00009, GTP_EFTU, 1 hit
PF03144, GTP_EFTU_D2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00315, ELONGATNFCT

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50447, SSF50447, 1 hit
SSF50465, SSF50465, 1 hit
SSF52540, SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51722, G_TR_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q2VIR3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGGEAGVTL GQPHLSRQDL TTLDVTKLTP LSHEVISRQA TINIGTIGHV
60 70 80 90 100
AHGKSTVVKA ISGVHTVRFK NELERNITIK LGYANAKIYQ LDDPSCPRPE
110 120 130 140 150
CYRSCGSSMP DEFPTDIPGT KGNFRLVRHV SFVDCPGHDI LMATMLNGAA
160 170 180 190 200
VMDAALLLIA GNESCPQPQT SEHLAAIEIM KLKHILILQN KIDLVKERQA
210 220 230 240 250
KEQYEQILAF VQGTVAEGAP IIPISAQLKY NIEVVCEYIV KKIPVPPRDF
260 270 280 290 300
TSEPRLIVIR SFDVNKPGCE VDDLKGGVAG GSILKGVLKV GQETEVRPGI
310 320 330 340 350
VSKDSEGKLM CKSIFSKIVS LFAEHNDLQY AAPGGLIGVG TKIDPTLCRA
360 370 380 390 400
DRMVGQILGA VGALPEIFTE LEISYFLLRR LLGVRTEGDK KAAKVQKLSK
410 420 430 440 450
NEVLMVNIGS LSTGGRVSAV KADLGKIVLT NPVCTEVGEK IALSRRVEKH
460 470
WRLIGWGQIR RGVTIKPTVD DD
Length:472
Mass (Da):51,229
Last modified:July 22, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6ECFD47900903ED9
GO
Isoform 2 (identifier: Q2VIR3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     437-472: VGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD → IHLIHLDLIKELEWGPVLTNETQRKSAANF

Show »
Length:466
Mass (Da):50,530
Checksum:i8B418E91C2828245
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence ABB92405 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAA07331 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti243I → F in ABB92405 (PubMed:16201836).Curated1
Sequence conflicti258V → G in CAA07331 (PubMed:9736774).Curated1
Sequence conflicti279A → T in CAA07331 (PubMed:9736774).Curated1
Sequence conflicti292Q → H in CAA07331 (PubMed:9736774).Curated1
Sequence conflicti300I → L in CAA07331 (PubMed:9736774).Curated1
Sequence conflicti313S → P in ABB92405 (PubMed:16201836).Curated1
Sequence conflicti313S → P in AAH87847 (PubMed:15489334).Curated1
Isoform 2 (identifier: Q2VIR3-2)
Sequence conflicti453V → L in AAH87847 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_034711437 – 472VGEKI…TVDDD → IHLIHLDLIKELEWGPVLTN ETQRKSAANF in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ120619 Genomic DNA Translation: ABB92405.1 Sequence problems.
AC068775 Genomic DNA No translation available.
BC087847 mRNA Translation: AAH87847.1
AJ006932 Genomic DNA Translation: CAA07331.1 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS86282.1 [Q2VIR3-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000322446; ENSP00000323063; ENSG00000180574 [Q2VIR3-2]
ENST00000538173; ENSP00000445077; ENSG00000180574 [Q2VIR3-1]

UCSC genome browser

More...
UCSCi
uc058lel.1, human [Q2VIR3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ120619 Genomic DNA Translation: ABB92405.1 Sequence problems.
AC068775 Genomic DNA No translation available.
BC087847 mRNA Translation: AAH87847.1
AJ006932 Genomic DNA Translation: CAA07331.1 Frameshift.
CCDSiCCDS86282.1 [Q2VIR3-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

IntActiQ2VIR3, 7 interactors
STRINGi9606.ENSP00000445077

PTM databases

iPTMnetiQ2VIR3
MetOSiteiQ2VIR3
PhosphoSitePlusiQ2VIR3
SwissPalmiQ2VIR3

Genetic variation databases

BioMutaiEIF2S3L
ENSG00000180574
DMDMi205830883

Proteomic databases

EPDiQ2VIR3
jPOSTiQ2VIR3
MassIVEiQ2VIR3
MaxQBiQ2VIR3
PaxDbiQ2VIR3
PeptideAtlasiQ2VIR3
PRIDEiQ2VIR3
ProteomicsDBi30052
61512 [Q2VIR3-1]
61513 [Q2VIR3-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
71457, 15 antibodies

Genome annotation databases

EnsembliENST00000322446; ENSP00000323063; ENSG00000180574 [Q2VIR3-2]
ENST00000538173; ENSP00000445077; ENSG00000180574 [Q2VIR3-1]
UCSCiuc058lel.1, human [Q2VIR3-1]

Organism-specific databases

GeneCards: human genes, protein and diseases

More...
GeneCardsi
EIF2S3B
HGNCiHGNC:43863, EIF2S3B
HPAiENSG00000180574, Tissue enhanced (testis)
neXtProtiNX_Q2VIR3
OpenTargetsiENSG00000180574
VEuPathDBiHostDB:ENSG00000180574

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0466, Eukaryota
GeneTreeiENSGT00550000074801
HOGENOMiCLU_027154_0_1_1
InParanoidiQ2VIR3
PhylomeDBiQ2VIR3
TreeFamiTF101513

Enzyme and pathway databases

PathwayCommonsiQ2VIR3

Miscellaneous databases

PharosiQ2VIR3, Tdark

Protein Ontology

More...
PROi
PR:Q2VIR3
RNActiQ2VIR3, protein

Gene expression databases

BgeeiENSG00000180574, Expressed in leukocyte and 81 other tissues
GenevisibleiQ2VIR3, HS

Family and domain databases

CDDicd01888, eIF2_gamma, 1 hit
cd03688, eIF2_gamma_II, 1 hit
cd15490, eIF2_gamma_III, 1 hit
Gene3Di3.40.50.300, 1 hit
InterProiView protein in InterPro
IPR004161, EFTu-like_2
IPR015256, eIF2g_C
IPR044127, eIF2g_dom_2
IPR044128, eIF2g_GTP-bd
IPR027417, P-loop_NTPase
IPR000795, T_Tr_GTP-bd_dom
IPR009000, Transl_B-barrel_sf
IPR009001, Transl_elong_EF1A/Init_IF2_C
PfamiView protein in Pfam
PF09173, eIF2_C, 1 hit
PF00009, GTP_EFTU, 1 hit
PF03144, GTP_EFTU_D2, 1 hit
PRINTSiPR00315, ELONGATNFCT
SUPFAMiSSF50447, SSF50447, 1 hit
SSF50465, SSF50465, 1 hit
SSF52540, SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS51722, G_TR_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIF2GL_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q2VIR3
Secondary accession number(s): F8W810, Q5I0X0, Q6KF84
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: July 22, 2008
Last modified: September 29, 2021
This is version 119 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Translation initiation factors
    List of translation initiation factor entries
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again