Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 119 (02 Jun 2021)
Sequence version 3 (02 Nov 2010)
Previous versions | rss
Add a publicationFeedback
Protein

Hexokinase HKDC1

Gene

HKDC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the phosphorylation of hexose to hexose 6-phosphate, although at very low level compared to other hexokinases (PubMed:30517626).

Has low glucose phosphorylating activity compared to other hexokinases (PubMed:30517626).

Involved in glucose homeostasis and hepatic lipid accumulation. Required to maintain whole-body glucose homeostasis during pregnancy; however additional evidences are required to confirm this role (By similarity).

By similarity1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: hexose metabolism

This protein is involved in the pathway hexose metabolism, which is part of Carbohydrate metabolism.1 Publication
View all proteins of this organism that are known to be involved in the pathway hexose metabolism and in Carbohydrate metabolism.

Pathwayi: glycolysis

This protein is involved in step 1 of the subpathway that synthesizes D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose.1 Publication This subpathway is part of the pathway glycolysis, which is itself part of Carbohydrate degradation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose, the pathway glycolysis and in Carbohydrate degradation.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei30ATP 1By similarity1
Binding sitei155Substrate 1By similarity1
Binding sitei209Glucose-6-phosphate 1By similarity1
Binding sitei232Glucose-6-phosphate 1By similarity1
Binding sitei235Substrate 1By similarity1
Binding sitei260Substrate 1By similarity1
Binding sitei449Glucose-6-phosphate 1By similarity1
Binding sitei656Glucose-6-phosphate 2By similarity1
Binding sitei679ATP 2By similarity1
Binding sitei679Glucose-6-phosphate 2By similarity1
Binding sitei707Substrate 2By similarity1
Binding sitei741Substrate 2By similarity1
Binding sitei896Glucose-6-phosphate 2By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi84 – 89ATP 1By similarity6
Nucleotide bindingi425 – 426ATP 1By similarity2
Nucleotide bindingi532 – 537ATP 2By similarity6
Nucleotide bindingi746 – 747ATP 2By similarity2
Nucleotide bindingi783 – 787ATP 2By similarity5
Nucleotide bindingi862 – 866ATP 2By similarity5

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Transferase
Biological processGlycolysis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q2TB90

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00109;UER00180
UPA00242

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Hexokinase HKDC1Curated (EC:2.7.1.11 Publication)
Alternative name(s):
Hexokinase domain-containing protein 1Curated
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HKDC1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23302, HKDC1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q2TB90

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000156510.12

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Membrane, Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
80201

Open Targets

More...
OpenTargetsi
ENSG00000156510

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134866195

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q2TB90, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1741200

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
HKDC1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
311033440

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002990351 – 917Hexokinase HKDC1Add BLAST917

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q2TB90

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q2TB90

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q2TB90

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q2TB90

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q2TB90

PeptideAtlas

More...
PeptideAtlasi
Q2TB90

PRoteomics IDEntifications database

More...
PRIDEi
Q2TB90

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
61483 [Q2TB90-1]
61484 [Q2TB90-2]
61485 [Q2TB90-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q2TB90

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q2TB90

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed (PubMed:27459389, PubMed:29401404). Highly expressed in the brush border, surface epithelium and the myenteric plexus of the small and large intestines; the acinar centrocytes and interlobular ducts of the pancreas; and the alveolar macrophages in the lungs (at protein level) (PubMed:29401404). Present at moderate level in the thyroid follicular epithelium (at protein level) (PubMed:29401404).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000156510, Expressed in duodenum and 152 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q2TB90, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000156510, Tissue enriched (intestine)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
123172, 11 interactors

Protein interaction database and analysis system

More...
IntActi
Q2TB90, 6 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000346643

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q2TB90, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q2TB90

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini16 – 458Hexokinase 1PROSITE-ProRule annotationAdd BLAST443
Domaini464 – 905Hexokinase 2PROSITE-ProRule annotationAdd BLAST442

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 20Mitochondrial-binding peptide (MBP)1 PublicationAdd BLAST20
Regioni73 – 207Hexokinase small subdomain 1PROSITE-ProRule annotationAdd BLAST135
Regioni84 – 91Glucose-6-phosphate 1 bindingBy similarity8
Regioni172 – 173Substrate 1 bindingBy similarity2
Regioni208 – 447Hexokinase large subdomain 1PROSITE-ProRule annotationAdd BLAST240
Regioni208 – 209Substrate 1 bindingBy similarity2
Regioni291 – 294Substrate 1 bindingBy similarity4
Regioni413 – 415Glucose-6-phosphate 1 bindingBy similarity3
Regioni521 – 654Hexokinase small subdomain 2PROSITE-ProRule annotationAdd BLAST134
Regioni532 – 536Glucose-6-phosphate 2 bindingBy similarity5
Regioni602 – 603Substrate 2 bindingBy similarity2
Regioni619 – 620Substrate 2 bindingBy similarity2
Regioni655 – 894Hexokinase large subdomain 2PROSITE-ProRule annotationAdd BLAST240
Regioni655 – 656Substrate 2 bindingBy similarity2
Regioni681 – 682Substrate 2 bindingBy similarity2
Regioni860 – 862Glucose-6-phosphate 2 bindingBy similarity3

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the hexokinase family.PROSITE-ProRule annotationCurated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1369, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182787

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_014393_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q2TB90

Identification of Orthologs from Complete Genome Data

More...
OMAi
CIEDIRT

Database of Orthologous Groups

More...
OrthoDBi
1153545at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q2TB90

TreeFam database of animal gene trees

More...
TreeFami
TF314238

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR043129, ATPase_NBD
IPR001312, Hexokinase
IPR019807, Hexokinase_BS
IPR022673, Hexokinase_C
IPR022672, Hexokinase_N

The PANTHER Classification System

More...
PANTHERi
PTHR19443, PTHR19443, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00349, Hexokinase_1, 2 hits
PF03727, Hexokinase_2, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53067, SSF53067, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00378, HEXOKINASE_1, 1 hit
PS51748, HEXOKINASE_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q2TB90-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFAVHLMAFY FSKLKEDQIK KVDRFLYHMR LSDDTLLDIM RRFRAEMEKG
60 70 80 90 100
LAKDTNPTAA VKMLPTFVRA IPDGSENGEF LSLDLGGSKF RVLKVQVAEE
110 120 130 140 150
GKRHVQMESQ FYPTPNEIIR GNGTELFEYV ADCLADFMKT KDLKHKKLPL
160 170 180 190 200
GLTFSFPCRQ TKLEEGVLLS WTKKFKARGV QDTDVVSRLT KAMRRHKDMD
210 220 230 240 250
VDILALVNDT VGTMMTCAYD DPYCEVGVII GTGTNACYME DMSNIDLVEG
260 270 280 290 300
DEGRMCINTE WGAFGDDGAL EDIRTEFDRE LDLGSLNPGK QLFEKMISGL
310 320 330 340 350
YLGELVRLIL LKMAKAGLLF GGEKSSALHT KGKIETRHVA AMEKYKEGLA
360 370 380 390 400
NTREILVDLG LEPSEADCIA VQHVCTIVSF RSANLCAAAL AAILTRLREN
410 420 430 440 450
KKVERLRTTV GMDGTLYKIH PQYPKRLHKV VRKLVPSCDV RFLLSESGST
460 470 480 490 500
KGAAMVTAVA SRVQAQRKQI DRVLALFQLT REQLVDVQAK MRAELEYGLK
510 520 530 540 550
KKSHGLATVR MLPTYVCGLP DGTEKGKFLA LDLGGTNFRV LLVKIRSGRR
560 570 580 590 600
SVRMYNKIFA IPLEIMQGTG EELFDHIVQC IADFLDYMGL KGASLPLGFT
610 620 630 640 650
FSFPCRQMSI DKGTLIGWTK GFKATDCEGE DVVDMLREAI KRRNEFDLDI
660 670 680 690 700
VAVVNDTVGT MMTCGYEDPN CEIGLIAGTG SNMCYMEDMR NIEMVEGGEG
710 720 730 740 750
KMCINTEWGG FGDNGCIDDI WTRYDTEVDE GSLNPGKQRY EKMTSGMYLG
760 770 780 790 800
EIVRQILIDL TKQGLLFRGQ ISERLRTRGI FETKFLSQIE SDRLALLQVR
810 820 830 840 850
RILQQLGLDS TCEDSIVVKE VCGAVSRRAA QLCGAGLAAI VEKRREDQGL
860 870 880 890 900
EHLRITVGVD GTLYKLHPHF SRILQETVKE LAPRCDVTFM LSEDGSGKGA
910
ALITAVAKRL QQAQKEN
Length:917
Mass (Da):102,545
Last modified:November 2, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF7E32F3F2B4118B6
GO
Isoform 2 (identifier: Q2TB90-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     791-806: SDRLALLQVRRILQQL → RMLSVIDAYCLDLLFH
     807-917: Missing.

Show »
Length:806
Mass (Da):90,575
Checksum:iF80F5F2C2DE8AAEA
GO
Isoform 3 (identifier: Q2TB90-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     705-736: NTEWGGFGDNGCIDDIWTRYDTEVDEGSLNPG → CFSFCLWFVLQVLIVVLRIVRYRKSSKLIKKF
     737-917: Missing.

Show »
Length:736
Mass (Da):82,682
Checksum:i20C1B85111209665
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH21278 differs from that shown. Reason: Frameshift.Curated
The sequence BAB15478 differs from that shown. Reason: Frameshift.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03477654D → G. Corresponds to variant dbSNP:rs10823320Ensembl.1
Natural variantiVAR_034777124T → I. Corresponds to variant dbSNP:rs874556Ensembl.1
Natural variantiVAR_034778204L → P. Corresponds to variant dbSNP:rs7899445Ensembl.1
Natural variantiVAR_034779721W → R2 PublicationsCorresponds to variant dbSNP:rs1111335Ensembl.1
Natural variantiVAR_034780917N → K. Corresponds to variant dbSNP:rs906219Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_027533705 – 736NTEWG…SLNPG → CFSFCLWFVLQVLIVVLRIV RYRKSSKLIKKF in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_027534737 – 917Missing in isoform 3. 1 PublicationAdd BLAST181
Alternative sequenceiVSP_027535791 – 806SDRLA…ILQQL → RMLSVIDAYCLDLLFH in isoform 2. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_027536807 – 917Missing in isoform 2. 1 PublicationAdd BLAST111

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL596223 Genomic DNA No translation available.
BC012337 mRNA Translation: AAH12337.1
BC021278 mRNA Translation: AAH21278.1 Frameshift.
BC110504 mRNA Translation: AAI10505.1
BC110505 mRNA Translation: AAI10506.2
AK026414 mRNA Translation: BAB15478.1 Frameshift.
BX538078 mRNA Translation: CAD98002.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS7288.1 [Q2TB90-1]

NCBI Reference Sequences

More...
RefSeqi
NP_079406.3, NM_025130.3 [Q2TB90-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000354624; ENSP00000346643; ENSG00000156510 [Q2TB90-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
80201

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:80201

UCSC genome browser

More...
UCSCi
uc001jpf.4, human [Q2TB90-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL596223 Genomic DNA No translation available.
BC012337 mRNA Translation: AAH12337.1
BC021278 mRNA Translation: AAH21278.1 Frameshift.
BC110504 mRNA Translation: AAI10505.1
BC110505 mRNA Translation: AAI10506.2
AK026414 mRNA Translation: BAB15478.1 Frameshift.
BX538078 mRNA Translation: CAD98002.1
CCDSiCCDS7288.1 [Q2TB90-1]
RefSeqiNP_079406.3, NM_025130.3 [Q2TB90-1]

3D structure databases

SMRiQ2TB90
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi123172, 11 interactors
IntActiQ2TB90, 6 interactors
STRINGi9606.ENSP00000346643

Chemistry databases

ChEMBLiCHEMBL1741200

PTM databases

iPTMnetiQ2TB90
PhosphoSitePlusiQ2TB90

Genetic variation databases

BioMutaiHKDC1
DMDMi311033440

Proteomic databases

EPDiQ2TB90
jPOSTiQ2TB90
MassIVEiQ2TB90
MaxQBiQ2TB90
PaxDbiQ2TB90
PeptideAtlasiQ2TB90
PRIDEiQ2TB90
ProteomicsDBi61483 [Q2TB90-1]
61484 [Q2TB90-2]
61485 [Q2TB90-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
2524, 145 antibodies

The DNASU plasmid repository

More...
DNASUi
80201

Genome annotation databases

EnsembliENST00000354624; ENSP00000346643; ENSG00000156510 [Q2TB90-1]
GeneIDi80201
KEGGihsa:80201
UCSCiuc001jpf.4, human [Q2TB90-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
80201
DisGeNETi80201

GeneCards: human genes, protein and diseases

More...
GeneCardsi
HKDC1
HGNCiHGNC:23302, HKDC1
HPAiENSG00000156510, Tissue enriched (intestine)
neXtProtiNX_Q2TB90
OpenTargetsiENSG00000156510
PharmGKBiPA134866195
VEuPathDBiHostDB:ENSG00000156510.12

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1369, Eukaryota
GeneTreeiENSGT00950000182787
HOGENOMiCLU_014393_1_0_1
InParanoidiQ2TB90
OMAiCIEDIRT
OrthoDBi1153545at2759
PhylomeDBiQ2TB90
TreeFamiTF314238

Enzyme and pathway databases

UniPathwayiUPA00109;UER00180
UPA00242
PathwayCommonsiQ2TB90

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
80201, 8 hits in 988 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
80201
PharosiQ2TB90, Tbio

Protein Ontology

More...
PROi
PR:Q2TB90
RNActiQ2TB90, protein

Gene expression databases

BgeeiENSG00000156510, Expressed in duodenum and 152 other tissues
GenevisibleiQ2TB90, HS

Family and domain databases

InterProiView protein in InterPro
IPR043129, ATPase_NBD
IPR001312, Hexokinase
IPR019807, Hexokinase_BS
IPR022673, Hexokinase_C
IPR022672, Hexokinase_N
PANTHERiPTHR19443, PTHR19443, 2 hits
PfamiView protein in Pfam
PF00349, Hexokinase_1, 2 hits
PF03727, Hexokinase_2, 2 hits
SUPFAMiSSF53067, SSF53067, 4 hits
PROSITEiView protein in PROSITE
PS00378, HEXOKINASE_1, 1 hit
PS51748, HEXOKINASE_2, 2 hits

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHKDC1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q2TB90
Secondary accession number(s): B5MDN9
, Q2TB91, Q5VTC7, Q7Z373, Q8WU37, Q96EH2, Q9H5Y9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: November 2, 2010
Last modified: June 2, 2021
This is version 119 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again