Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Putative hexokinase HKDC1

Gene

HKDC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalytic activityi

ATP + D-hexose = ADP + D-hexose 6-phosphate.

Pathwayi: hexose metabolism

This protein is involved in the pathway hexose metabolism, which is part of Carbohydrate metabolism.
View all proteins of this organism that are known to be involved in the pathway hexose metabolism and in Carbohydrate metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei557ATPSequence analysis1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi84 – 89ATPSequence analysis6
Nucleotide bindingi532 – 537ATPSequence analysis6

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • fructokinase activity Source: GO_Central
  • glucokinase activity Source: GO_Central
  • glucose binding Source: InterPro
  • mannokinase activity Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionKinase, Transferase
Biological processGlycolysis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

UniPathwayi
UPA00242

Names & Taxonomyi

Protein namesi
Recommended name:
Putative hexokinase HKDC1 (EC:2.7.1.1)
Alternative name(s):
Hexokinase domain-containing protein 1
Gene namesi
Name:HKDC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000156510.12
HGNCiHGNC:23302 HKDC1
neXtProtiNX_Q2TB90

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi80201
OpenTargetsiENSG00000156510
PharmGKBiPA134866195

Chemistry databases

ChEMBLiCHEMBL1741200

Polymorphism and mutation databases

BioMutaiHKDC1
DMDMi311033440

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002990351 – 917Putative hexokinase HKDC1Add BLAST917

Proteomic databases

EPDiQ2TB90
MaxQBiQ2TB90
PaxDbiQ2TB90
PeptideAtlasiQ2TB90
PRIDEiQ2TB90
ProteomicsDBi61483
61484 [Q2TB90-2]
61485 [Q2TB90-3]

PTM databases

iPTMnetiQ2TB90
PhosphoSitePlusiQ2TB90

Expressioni

Gene expression databases

BgeeiENSG00000156510 Expressed in 132 organ(s), highest expression level in jejunal mucosa
CleanExiHS_HKDC1
GenevisibleiQ2TB90 HS

Organism-specific databases

HPAiHPA011956
HPA064198
HPA064230

Interactioni

Protein-protein interaction databases

BioGridi123172, 4 interactors
IntActiQ2TB90, 1 interactor
STRINGi9606.ENSP00000346643

Structurei

3D structure databases

ProteinModelPortaliQ2TB90
SMRiQ2TB90
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini16 – 458Hexokinase 1PROSITE-ProRule annotationAdd BLAST443
Domaini464 – 905Hexokinase 2PROSITE-ProRule annotationAdd BLAST442

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni73 – 207Hexokinase small subdomain 1PROSITE-ProRule annotationAdd BLAST135
Regioni149 – 175Glucose-bindingSequence analysisAdd BLAST27
Regioni208 – 447Hexokinase large subdomain 1PROSITE-ProRule annotationAdd BLAST240
Regioni521 – 654Hexokinase small subdomain 2PROSITE-ProRule annotationAdd BLAST134
Regioni596 – 622Glucose-bindingSequence analysisAdd BLAST27
Regioni655 – 894Hexokinase large subdomain 2PROSITE-ProRule annotationAdd BLAST240

Sequence similaritiesi

Belongs to the hexokinase family.PROSITE-ProRule annotationCurated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1369 Eukaryota
COG5026 LUCA
GeneTreeiENSGT00390000017159
HOVERGENiHBG005020
InParanoidiQ2TB90
KOiK00844
OMAiKIETRHV
OrthoDBiEOG091G08MD
PhylomeDBiQ2TB90
TreeFamiTF314238

Family and domain databases

InterProiView protein in InterPro
IPR001312 Hexokinase
IPR019807 Hexokinase_BS
IPR022673 Hexokinase_C
IPR022672 Hexokinase_N
PANTHERiPTHR19443 PTHR19443, 4 hits
PfamiView protein in Pfam
PF00349 Hexokinase_1, 2 hits
PF03727 Hexokinase_2, 2 hits
PROSITEiView protein in PROSITE
PS00378 HEXOKINASE_1, 1 hit
PS51748 HEXOKINASE_2, 2 hits

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q2TB90-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFAVHLMAFY FSKLKEDQIK KVDRFLYHMR LSDDTLLDIM RRFRAEMEKG
60 70 80 90 100
LAKDTNPTAA VKMLPTFVRA IPDGSENGEF LSLDLGGSKF RVLKVQVAEE
110 120 130 140 150
GKRHVQMESQ FYPTPNEIIR GNGTELFEYV ADCLADFMKT KDLKHKKLPL
160 170 180 190 200
GLTFSFPCRQ TKLEEGVLLS WTKKFKARGV QDTDVVSRLT KAMRRHKDMD
210 220 230 240 250
VDILALVNDT VGTMMTCAYD DPYCEVGVII GTGTNACYME DMSNIDLVEG
260 270 280 290 300
DEGRMCINTE WGAFGDDGAL EDIRTEFDRE LDLGSLNPGK QLFEKMISGL
310 320 330 340 350
YLGELVRLIL LKMAKAGLLF GGEKSSALHT KGKIETRHVA AMEKYKEGLA
360 370 380 390 400
NTREILVDLG LEPSEADCIA VQHVCTIVSF RSANLCAAAL AAILTRLREN
410 420 430 440 450
KKVERLRTTV GMDGTLYKIH PQYPKRLHKV VRKLVPSCDV RFLLSESGST
460 470 480 490 500
KGAAMVTAVA SRVQAQRKQI DRVLALFQLT REQLVDVQAK MRAELEYGLK
510 520 530 540 550
KKSHGLATVR MLPTYVCGLP DGTEKGKFLA LDLGGTNFRV LLVKIRSGRR
560 570 580 590 600
SVRMYNKIFA IPLEIMQGTG EELFDHIVQC IADFLDYMGL KGASLPLGFT
610 620 630 640 650
FSFPCRQMSI DKGTLIGWTK GFKATDCEGE DVVDMLREAI KRRNEFDLDI
660 670 680 690 700
VAVVNDTVGT MMTCGYEDPN CEIGLIAGTG SNMCYMEDMR NIEMVEGGEG
710 720 730 740 750
KMCINTEWGG FGDNGCIDDI WTRYDTEVDE GSLNPGKQRY EKMTSGMYLG
760 770 780 790 800
EIVRQILIDL TKQGLLFRGQ ISERLRTRGI FETKFLSQIE SDRLALLQVR
810 820 830 840 850
RILQQLGLDS TCEDSIVVKE VCGAVSRRAA QLCGAGLAAI VEKRREDQGL
860 870 880 890 900
EHLRITVGVD GTLYKLHPHF SRILQETVKE LAPRCDVTFM LSEDGSGKGA
910
ALITAVAKRL QQAQKEN
Length:917
Mass (Da):102,545
Last modified:November 2, 2010 - v3
Checksum:iF7E32F3F2B4118B6
GO
Isoform 2 (identifier: Q2TB90-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     791-806: SDRLALLQVRRILQQL → RMLSVIDAYCLDLLFH
     807-917: Missing.

Note: No experimental confirmation available.
Show »
Length:806
Mass (Da):90,575
Checksum:iF80F5F2C2DE8AAEA
GO
Isoform 3 (identifier: Q2TB90-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     705-736: NTEWGGFGDNGCIDDIWTRYDTEVDEGSLNPG → CFSFCLWFVLQVLIVVLRIVRYRKSSKLIKKF
     737-917: Missing.

Note: No experimental confirmation available.
Show »
Length:736
Mass (Da):82,682
Checksum:i20C1B85111209665
GO

Sequence cautioni

The sequence AAH21278 differs from that shown. Reason: Frameshift at position 457.Curated
The sequence BAB15478 differs from that shown. Reason: Frameshift at position 345.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03477654D → G. Corresponds to variant dbSNP:rs10823320Ensembl.1
Natural variantiVAR_034777124T → I. Corresponds to variant dbSNP:rs874556Ensembl.1
Natural variantiVAR_034778204L → P. Corresponds to variant dbSNP:rs7899445Ensembl.1
Natural variantiVAR_034779721W → R2 PublicationsCorresponds to variant dbSNP:rs1111335Ensembl.1
Natural variantiVAR_034780917N → K. Corresponds to variant dbSNP:rs906219Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_027533705 – 736NTEWG…SLNPG → CFSFCLWFVLQVLIVVLRIV RYRKSSKLIKKF in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_027534737 – 917Missing in isoform 3. 1 PublicationAdd BLAST181
Alternative sequenceiVSP_027535791 – 806SDRLA…ILQQL → RMLSVIDAYCLDLLFH in isoform 2. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_027536807 – 917Missing in isoform 2. 1 PublicationAdd BLAST111

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL596223 Genomic DNA No translation available.
BC012337 mRNA Translation: AAH12337.1
BC021278 mRNA Translation: AAH21278.1 Frameshift.
BC110504 mRNA Translation: AAI10505.1
BC110505 mRNA Translation: AAI10506.2
AK026414 mRNA Translation: BAB15478.1 Frameshift.
BX538078 mRNA Translation: CAD98002.1
CCDSiCCDS7288.1 [Q2TB90-1]
RefSeqiNP_079406.3, NM_025130.3
UniGeneiHs.522988

Genome annotation databases

EnsembliENST00000354624; ENSP00000346643; ENSG00000156510 [Q2TB90-1]
GeneIDi80201
KEGGihsa:80201
UCSCiuc001jpf.4 human [Q2TB90-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL596223 Genomic DNA No translation available.
BC012337 mRNA Translation: AAH12337.1
BC021278 mRNA Translation: AAH21278.1 Frameshift.
BC110504 mRNA Translation: AAI10505.1
BC110505 mRNA Translation: AAI10506.2
AK026414 mRNA Translation: BAB15478.1 Frameshift.
BX538078 mRNA Translation: CAD98002.1
CCDSiCCDS7288.1 [Q2TB90-1]
RefSeqiNP_079406.3, NM_025130.3
UniGeneiHs.522988

3D structure databases

ProteinModelPortaliQ2TB90
SMRiQ2TB90
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123172, 4 interactors
IntActiQ2TB90, 1 interactor
STRINGi9606.ENSP00000346643

Chemistry databases

ChEMBLiCHEMBL1741200

PTM databases

iPTMnetiQ2TB90
PhosphoSitePlusiQ2TB90

Polymorphism and mutation databases

BioMutaiHKDC1
DMDMi311033440

Proteomic databases

EPDiQ2TB90
MaxQBiQ2TB90
PaxDbiQ2TB90
PeptideAtlasiQ2TB90
PRIDEiQ2TB90
ProteomicsDBi61483
61484 [Q2TB90-2]
61485 [Q2TB90-3]

Protocols and materials databases

DNASUi80201
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000354624; ENSP00000346643; ENSG00000156510 [Q2TB90-1]
GeneIDi80201
KEGGihsa:80201
UCSCiuc001jpf.4 human [Q2TB90-1]

Organism-specific databases

CTDi80201
DisGeNETi80201
EuPathDBiHostDB:ENSG00000156510.12
GeneCardsiHKDC1
HGNCiHGNC:23302 HKDC1
HPAiHPA011956
HPA064198
HPA064230
neXtProtiNX_Q2TB90
OpenTargetsiENSG00000156510
PharmGKBiPA134866195
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1369 Eukaryota
COG5026 LUCA
GeneTreeiENSGT00390000017159
HOVERGENiHBG005020
InParanoidiQ2TB90
KOiK00844
OMAiKIETRHV
OrthoDBiEOG091G08MD
PhylomeDBiQ2TB90
TreeFamiTF314238

Enzyme and pathway databases

UniPathwayi
UPA00242

Miscellaneous databases

GenomeRNAii80201
PROiPR:Q2TB90

Gene expression databases

BgeeiENSG00000156510 Expressed in 132 organ(s), highest expression level in jejunal mucosa
CleanExiHS_HKDC1
GenevisibleiQ2TB90 HS

Family and domain databases

InterProiView protein in InterPro
IPR001312 Hexokinase
IPR019807 Hexokinase_BS
IPR022673 Hexokinase_C
IPR022672 Hexokinase_N
PANTHERiPTHR19443 PTHR19443, 4 hits
PfamiView protein in Pfam
PF00349 Hexokinase_1, 2 hits
PF03727 Hexokinase_2, 2 hits
PROSITEiView protein in PROSITE
PS00378 HEXOKINASE_1, 1 hit
PS51748 HEXOKINASE_2, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiHKDC1_HUMAN
AccessioniPrimary (citable) accession number: Q2TB90
Secondary accession number(s): B5MDN9
, Q2TB91, Q5VTC7, Q7Z373, Q8WU37, Q96EH2, Q9H5Y9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: November 2, 2010
Last modified: September 12, 2018
This is version 101 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again