Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 117 (16 Oct 2019)
Sequence version 2 (15 May 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ral GTPase-activating protein subunit alpha-2

Gene

RALGAPA2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalytic subunit of the heterodimeric RalGAP2 complex which acts as a GTPase activator for the Ras-like small GTPases RALA and RALB.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1445148 Translocation of SLC2A4 (GLUT4) to the plasma membrane

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ral GTPase-activating protein subunit alpha-2
Alternative name(s):
250 kDa substrate of Akt
Short name:
AS250
p220
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RALGAPA2
Synonyms:C20orf74, KIAA1272
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16207 RALGAPA2

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q2PPJ7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
57186

Open Targets

More...
OpenTargetsi
ENSG00000188559

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25784

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q2PPJ7

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RALGAPA2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
147742932

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002869721 – 1873Ral GTPase-activating protein subunit alpha-2Add BLAST1873

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei373PhosphoserineBy similarity1
Modified residuei376PhosphoserineBy similarity1
Modified residuei379PhosphoserineBy similarity1
Modified residuei486Phosphoserine; by PKBCombined sources1 Publication1
Modified residuei696Phosphoserine; by PKBCombined sources1 Publication1
Modified residuei715Phosphothreonine; by PKB1 Publication1
Modified residuei820PhosphoserineCombined sources1
Modified residuei821PhosphoserineCombined sources1
Modified residuei1593PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q2PPJ7

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q2PPJ7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q2PPJ7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q2PPJ7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q2PPJ7

PeptideAtlas

More...
PeptideAtlasi
Q2PPJ7

PRoteomics IDEntifications database

More...
PRIDEi
Q2PPJ7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
61429 [Q2PPJ7-1]
61430 [Q2PPJ7-2]
61431 [Q2PPJ7-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q2PPJ7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q2PPJ7

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q2PPJ7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000188559 Expressed in 193 organ(s), highest expression level in placenta

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q2PPJ7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q2PPJ7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA042707
HPA043622

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the heterodimeric RalGAP2 complex with RALGAPB. Heterodimerization is required for activity (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121435, 11 interactors

Protein interaction database and analysis system

More...
IntActi
Q2PPJ7, 6 interactors

Molecular INTeraction database

More...
MINTi
Q2PPJ7

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000202677

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q2PPJ7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1635 – 1843Rap-GAPPROSITE-ProRule annotationAdd BLAST209

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi757 – 760Poly-Gln4
Compositional biasi790 – 793Poly-Ser4

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3686 Eukaryota
ENOG410XTIX LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183139

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q2PPJ7

Identification of Orthologs from Complete Genome Data

More...
OMAi
WWPREQM

Database of Orthologous Groups

More...
OrthoDBi
157372at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q2PPJ7

TreeFam database of animal gene trees

More...
TreeFami
TF324484

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.11210, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016024 ARM-type_fold
IPR035974 Rap/Ran-GAP_sf
IPR000331 Rap_GAP_dom
IPR027107 Tuberin/Ral-act_asu

The PANTHER Classification System

More...
PANTHERi
PTHR10063 PTHR10063, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02145 Rap_GAP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF111347 SSF111347, 1 hit
SSF48371 SSF48371, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50085 RAPGAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q2PPJ7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFSRRSHGDV KKSTQKVLDP KKDVLTRLKH LRALLDNVDA NDLKQFFETN
60 70 80 90 100
YSQIYFIFYE NFIALENSLK LKGNNKSQRE ELDSILFLFE KILQFLPERI
110 120 130 140 150
FFRWHYQSIG STLKKLLHTG NSIKIRCEGI RLFLLWLQAL QTNCAEEQVL
160 170 180 190 200
IFACLVPGFP AVMSSRGPCT LETLINPSPS VADVKIYPEE ITPLLPAISG
210 220 230 240 250
EKIAEDQTCF FLQILLKYMV IQAASLEWKN KENQDTGFKF LFTLFRKYYL
260 270 280 290 300
PHLFPSFTKL TNIYKPVLDI PHLRPKPVYI TTTRDNENIY STKIPYMAAR
310 320 330 340 350
VVFIKWIVTF FLEKKYLTAT QNTKNGVDVL PKIIQTVGGG AVQERAPELD
360 370 380 390 400
GGGPTEQDKS HSNSSTLSDR RLSNSSLCSI EEEHRMVYEM VQRILLSTRG
410 420 430 440 450
YVNFVNEVFH QAFLLPSCEI AVTRKVVQVY RKWILQDKPV FMEEPDRKDV
460 470 480 490 500
AQEDAEKLGF SETDSKEASS ESSGHKRSSS WGRTYSFTSA MSRGCVTEEE
510 520 530 540 550
NTNVKAGVQA LLQVFLTNSA NIFLLEPCAE VPVLLKEQVD ACKAVLIIFR
560 570 580 590 600
RMIMELTMNK KTWEQMLQIL LRITEAVMQK PKDKQIKDLF AQSLAGLLFR
610 620 630 640 650
TLMVAWIRAN LCVYISRELW DDFLGVLSSL TEWEELINEW ANIMDSLTAV
660 670 680 690 700
LARTVYGVEM TNLPLDKLSE QKEKKQRGKG CVLDPQKGTT VGRSFSLSWR
710 720 730 740 750
SHPDVTEPMR FRSATTSGAP GVEKARNIVR QKATEVEECQ QSENAPAAGS
760 770 780 790 800
GHLTVGQQQQ VLRSSSTSDI PEPLCSDSSQ GQKAENTQNS SSSEPQPIQE
810 820 830 840 850
NKGHVKREHE GITILVRRSS SPAELDLKDD LQQTQGKCRE RQKSESTNSD
860 870 880 890 900
TTLGCTNEAE LSMGPWQTCE EDPELNTPTD VVADADARHW LQLSPTDASN
910 920 930 940 950
LTDSSECLTD DCSIIAGGSL TGWHPDSAAV LWRRVLGILG DVNNIQSPKI
960 970 980 990 1000
HARVFCYLYE LWYKLAKIRD NLAISLDNQS SPSPPVLIPP LRMFASWLFK
1010 1020 1030 1040 1050
AATLPNEYKE GKLQAYRLIC AMMTRRQDVL PNSDFLVHFY LVMHLGLTSE
1060 1070 1080 1090 1100
DQDILNTIIR HCPPRFFSLG FPGFSMLVGD FITAAARVLS TDILTAPRSE
1110 1120 1130 1140 1150
AVTVLGSLVC FPNTYQEIPL LQSVPEVNEA ITGTEDVKHY LINILLKNAT
1160 1170 1180 1190 1200
EEPNEYARCI AVCSLGVWIC EELAQCTSHP QVKEAINVIG VTLKFPNKIV
1210 1220 1230 1240 1250
AQVACDVLQL LVSYWEKLQM FETSLPRKMA EILVATVAFL LPSAEYSSVE
1260 1270 1280 1290 1300
TDKKFIVSLL LCLLDWCMAL PVSVLLHPVS TAVLEEQHSA RAPLLDYIYR
1310 1320 1330 1340 1350
VLHCCVCGSS TYTQQSHYIL TLADLSSTDY DPFLPLANVK SSEPVQYHSS
1360 1370 1380 1390 1400
AELGNLLTVE EEKKRRSLEL IPLTARMVMA HLVNHLGHYP LSGGPAILHS
1410 1420 1430 1440 1450
LVSENHDNAH VEGSELSFEV FRSPNLQLFV FNDSTLISYL QTPTEGPVGG
1460 1470 1480 1490 1500
SPVGSLSDVR VIVRDISGKY SWDGKVLYGP LEGCLAPNGR NPSFLISSWH
1510 1520 1530 1540 1550
RDTFGPQKDS SQVEEGDDVL DKLLENIGHT SPECLLPSQL NLNEPSLTPC
1560 1570 1580 1590 1600
GMNYDQEKEI IEVILRQNAQ EDEYIQSHNF DSAMKVTSQG QPSPVEPRGP
1610 1620 1630 1640 1650
FYFCRLLLDD LGMNSWDRRK NFHLLKKNSK LLRELKNLDS RQCRETHKIA
1660 1670 1680 1690 1700
VFYIAEGQED KCSILSNERG SQAYEDFVAG LGWEVDLSTH CGFMGGLQRN
1710 1720 1730 1740 1750
GSTGQTAPYY ATSTVEVIFH VSTRMPSDSD DSLTKKLRHL GNDEVHIVWS
1760 1770 1780 1790 1800
EHSRDYRRGI IPTAFGDVSI IIYPMKNHMF FIAITKKPEV PFFGPLFDGA
1810 1820 1830 1840 1850
IVSGKLLPSL VCATCINASR AVKCLIPLYQ SFYEERALYL EAIIQNHREV
1860 1870
MTFEDFAAQV FSPSPSYSLS GTD
Length:1,873
Mass (Da):210,770
Last modified:May 15, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDC33C087B4802541
GO
Isoform 2 (identifier: Q2PPJ7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1832-1873: FYEERALYLEAIIQNHREVMTFEDFAAQVFSPSPSYSLSGTD → LYLFALNV

Show »
Length:1,839
Mass (Da):206,862
Checksum:i9A546D26DD09D1B9
GO
Isoform 3 (identifier: Q2PPJ7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1832-1873: FYEERALYLEAIIQNHREVMTFEDFAAQVFSPSPSYSLSGTD → PRVR

Show »
Length:1,835
Mass (Da):206,436
Checksum:i10DC3EF9E46D8382
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C1F9H7C1F9_HUMAN
Ral GTPase-activating protein subun...
RALGAPA2
1,740Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BZA8H7BZA8_HUMAN
Ral GTPase-activating protein subun...
RALGAPA2
250Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WYA8A0A087WYA8_HUMAN
Ral GTPase-activating protein subun...
RALGAPA2
237Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3IS41A0A3B3IS41_HUMAN
Ral GTPase-activating protein subun...
RALGAPA2
227Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH13749 differs from that shown. Reason: Frameshift.Curated
The sequence BAB14290 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1488N → S in ABC33805 (PubMed:16490346).Curated1
Sequence conflicti1488N → S in BAA86586 (PubMed:10574462).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_049157492S → N. Corresponds to variant dbSNP:rs6137081Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0252471832 – 1873FYEER…LSGTD → LYLFALNV in isoform 2. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_0252481832 – 1873FYEER…LSGTD → PRVR in isoform 3. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ310704 mRNA Translation: ABC33805.1
AL078634 Genomic DNA No translation available.
AL121896 Genomic DNA No translation available.
AL157718 Genomic DNA No translation available.
AL161658 Genomic DNA No translation available.
AB033098 mRNA Translation: BAA86586.1
AK022881 mRNA Translation: BAB14290.1 Different initiation.
BC013749 mRNA Translation: AAH13749.1 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46584.1 [Q2PPJ7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_065076.2, NM_020343.3 [Q2PPJ7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000202677; ENSP00000202677; ENSG00000188559 [Q2PPJ7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57186

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57186

UCSC genome browser

More...
UCSCi
uc002wrz.4 human [Q2PPJ7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ310704 mRNA Translation: ABC33805.1
AL078634 Genomic DNA No translation available.
AL121896 Genomic DNA No translation available.
AL157718 Genomic DNA No translation available.
AL161658 Genomic DNA No translation available.
AB033098 mRNA Translation: BAA86586.1
AK022881 mRNA Translation: BAB14290.1 Different initiation.
BC013749 mRNA Translation: AAH13749.1 Frameshift.
CCDSiCCDS46584.1 [Q2PPJ7-1]
RefSeqiNP_065076.2, NM_020343.3 [Q2PPJ7-1]

3D structure databases

SMRiQ2PPJ7
ModBaseiSearch...

Protein-protein interaction databases

BioGridi121435, 11 interactors
IntActiQ2PPJ7, 6 interactors
MINTiQ2PPJ7
STRINGi9606.ENSP00000202677

PTM databases

iPTMnetiQ2PPJ7
PhosphoSitePlusiQ2PPJ7
SwissPalmiQ2PPJ7

Polymorphism and mutation databases

BioMutaiRALGAPA2
DMDMi147742932

Proteomic databases

EPDiQ2PPJ7
jPOSTiQ2PPJ7
MassIVEiQ2PPJ7
MaxQBiQ2PPJ7
PaxDbiQ2PPJ7
PeptideAtlasiQ2PPJ7
PRIDEiQ2PPJ7
ProteomicsDBi61429 [Q2PPJ7-1]
61430 [Q2PPJ7-2]
61431 [Q2PPJ7-3]

Genome annotation databases

EnsembliENST00000202677; ENSP00000202677; ENSG00000188559 [Q2PPJ7-1]
GeneIDi57186
KEGGihsa:57186
UCSCiuc002wrz.4 human [Q2PPJ7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57186
DisGeNETi57186

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RALGAPA2
HGNCiHGNC:16207 RALGAPA2
HPAiHPA042707
HPA043622
neXtProtiNX_Q2PPJ7
OpenTargetsiENSG00000188559
PharmGKBiPA25784

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3686 Eukaryota
ENOG410XTIX LUCA
GeneTreeiENSGT00950000183139
InParanoidiQ2PPJ7
OMAiWWPREQM
OrthoDBi157372at2759
PhylomeDBiQ2PPJ7
TreeFamiTF324484

Enzyme and pathway databases

ReactomeiR-HSA-1445148 Translocation of SLC2A4 (GLUT4) to the plasma membrane

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RALGAPA2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57186
PharosiQ2PPJ7

Protein Ontology

More...
PROi
PR:Q2PPJ7

Gene expression databases

BgeeiENSG00000188559 Expressed in 193 organ(s), highest expression level in placenta
ExpressionAtlasiQ2PPJ7 baseline and differential
GenevisibleiQ2PPJ7 HS

Family and domain databases

Gene3Di3.40.50.11210, 1 hit
InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR035974 Rap/Ran-GAP_sf
IPR000331 Rap_GAP_dom
IPR027107 Tuberin/Ral-act_asu
PANTHERiPTHR10063 PTHR10063, 1 hit
PfamiView protein in Pfam
PF02145 Rap_GAP, 1 hit
SUPFAMiSSF111347 SSF111347, 1 hit
SSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS50085 RAPGAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRGPA2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q2PPJ7
Secondary accession number(s): Q4VXU6
, Q5JUA3, Q5JUA4, Q5T9K3, Q96CX9, Q9BQT7, Q9H9D9, Q9ULE8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: May 15, 2007
Last modified: October 16, 2019
This is version 117 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again