Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ral GTPase-activating protein subunit alpha-2

Gene

RALGAPA2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalytic subunit of the heterodimeric RalGAP2 complex which acts as a GTPase activator for the Ras-like small GTPases RALA and RALB.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGTPase activation

Enzyme and pathway databases

ReactomeiR-HSA-1445148 Translocation of GLUT4 to the plasma membrane

Names & Taxonomyi

Protein namesi
Recommended name:
Ral GTPase-activating protein subunit alpha-2
Alternative name(s):
250 kDa substrate of Akt
Short name:
AS250
p220
Gene namesi
Name:RALGAPA2
Synonyms:C20orf74, KIAA1272
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

EuPathDBiHostDB:ENSG00000188559.13
HGNCiHGNC:16207 RALGAPA2
neXtProtiNX_Q2PPJ7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi57186
OpenTargetsiENSG00000188559
PharmGKBiPA25784

Polymorphism and mutation databases

BioMutaiRALGAPA2
DMDMi147742932

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002869721 – 1873Ral GTPase-activating protein subunit alpha-2Add BLAST1873

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei373PhosphoserineBy similarity1
Modified residuei376PhosphoserineBy similarity1
Modified residuei379PhosphoserineBy similarity1
Modified residuei486Phosphoserine; by PKBCombined sources1 Publication1
Modified residuei696Phosphoserine; by PKBCombined sources1 Publication1
Modified residuei715Phosphothreonine; by PKB1 Publication1
Modified residuei820PhosphoserineCombined sources1
Modified residuei821PhosphoserineCombined sources1
Modified residuei1593PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ2PPJ7
MaxQBiQ2PPJ7
PaxDbiQ2PPJ7
PeptideAtlasiQ2PPJ7
PRIDEiQ2PPJ7
ProteomicsDBi61429
61430 [Q2PPJ7-2]
61431 [Q2PPJ7-3]

PTM databases

iPTMnetiQ2PPJ7
PhosphoSitePlusiQ2PPJ7
SwissPalmiQ2PPJ7

Expressioni

Gene expression databases

BgeeiENSG00000188559
CleanExiHS_C20orf74
ExpressionAtlasiQ2PPJ7 baseline and differential
GenevisibleiQ2PPJ7 HS

Organism-specific databases

HPAiHPA042707
HPA043622

Interactioni

Subunit structurei

Component of the heterodimeric RalGAP2 complex with RALGAPB. Heterodimerization is required for activity (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi121435, 6 interactors
IntActiQ2PPJ7, 2 interactors
MINTiQ2PPJ7
STRINGi9606.ENSP00000202677

Structurei

3D structure databases

ProteinModelPortaliQ2PPJ7
SMRiQ2PPJ7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1635 – 1843Rap-GAPPROSITE-ProRule annotationAdd BLAST209

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi757 – 760Poly-Gln4
Compositional biasi790 – 793Poly-Ser4

Phylogenomic databases

eggNOGiKOG3686 Eukaryota
ENOG410XTIX LUCA
GeneTreeiENSGT00760000119182
HOVERGENiHBG051842
InParanoidiQ2PPJ7
OMAiKCLIPLY
OrthoDBiEOG091G005P
PhylomeDBiQ2PPJ7
TreeFamiTF324484

Family and domain databases

Gene3Di3.40.50.11210, 1 hit
InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR035974 Rap/Ran-GAP_sf
IPR000331 Rap_GAP_dom
IPR027107 Tuberin/Ral-act_asu
PANTHERiPTHR10063 PTHR10063, 1 hit
PfamiView protein in Pfam
PF02145 Rap_GAP, 1 hit
SUPFAMiSSF111347 SSF111347, 1 hit
SSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS50085 RAPGAP, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q2PPJ7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFSRRSHGDV KKSTQKVLDP KKDVLTRLKH LRALLDNVDA NDLKQFFETN
60 70 80 90 100
YSQIYFIFYE NFIALENSLK LKGNNKSQRE ELDSILFLFE KILQFLPERI
110 120 130 140 150
FFRWHYQSIG STLKKLLHTG NSIKIRCEGI RLFLLWLQAL QTNCAEEQVL
160 170 180 190 200
IFACLVPGFP AVMSSRGPCT LETLINPSPS VADVKIYPEE ITPLLPAISG
210 220 230 240 250
EKIAEDQTCF FLQILLKYMV IQAASLEWKN KENQDTGFKF LFTLFRKYYL
260 270 280 290 300
PHLFPSFTKL TNIYKPVLDI PHLRPKPVYI TTTRDNENIY STKIPYMAAR
310 320 330 340 350
VVFIKWIVTF FLEKKYLTAT QNTKNGVDVL PKIIQTVGGG AVQERAPELD
360 370 380 390 400
GGGPTEQDKS HSNSSTLSDR RLSNSSLCSI EEEHRMVYEM VQRILLSTRG
410 420 430 440 450
YVNFVNEVFH QAFLLPSCEI AVTRKVVQVY RKWILQDKPV FMEEPDRKDV
460 470 480 490 500
AQEDAEKLGF SETDSKEASS ESSGHKRSSS WGRTYSFTSA MSRGCVTEEE
510 520 530 540 550
NTNVKAGVQA LLQVFLTNSA NIFLLEPCAE VPVLLKEQVD ACKAVLIIFR
560 570 580 590 600
RMIMELTMNK KTWEQMLQIL LRITEAVMQK PKDKQIKDLF AQSLAGLLFR
610 620 630 640 650
TLMVAWIRAN LCVYISRELW DDFLGVLSSL TEWEELINEW ANIMDSLTAV
660 670 680 690 700
LARTVYGVEM TNLPLDKLSE QKEKKQRGKG CVLDPQKGTT VGRSFSLSWR
710 720 730 740 750
SHPDVTEPMR FRSATTSGAP GVEKARNIVR QKATEVEECQ QSENAPAAGS
760 770 780 790 800
GHLTVGQQQQ VLRSSSTSDI PEPLCSDSSQ GQKAENTQNS SSSEPQPIQE
810 820 830 840 850
NKGHVKREHE GITILVRRSS SPAELDLKDD LQQTQGKCRE RQKSESTNSD
860 870 880 890 900
TTLGCTNEAE LSMGPWQTCE EDPELNTPTD VVADADARHW LQLSPTDASN
910 920 930 940 950
LTDSSECLTD DCSIIAGGSL TGWHPDSAAV LWRRVLGILG DVNNIQSPKI
960 970 980 990 1000
HARVFCYLYE LWYKLAKIRD NLAISLDNQS SPSPPVLIPP LRMFASWLFK
1010 1020 1030 1040 1050
AATLPNEYKE GKLQAYRLIC AMMTRRQDVL PNSDFLVHFY LVMHLGLTSE
1060 1070 1080 1090 1100
DQDILNTIIR HCPPRFFSLG FPGFSMLVGD FITAAARVLS TDILTAPRSE
1110 1120 1130 1140 1150
AVTVLGSLVC FPNTYQEIPL LQSVPEVNEA ITGTEDVKHY LINILLKNAT
1160 1170 1180 1190 1200
EEPNEYARCI AVCSLGVWIC EELAQCTSHP QVKEAINVIG VTLKFPNKIV
1210 1220 1230 1240 1250
AQVACDVLQL LVSYWEKLQM FETSLPRKMA EILVATVAFL LPSAEYSSVE
1260 1270 1280 1290 1300
TDKKFIVSLL LCLLDWCMAL PVSVLLHPVS TAVLEEQHSA RAPLLDYIYR
1310 1320 1330 1340 1350
VLHCCVCGSS TYTQQSHYIL TLADLSSTDY DPFLPLANVK SSEPVQYHSS
1360 1370 1380 1390 1400
AELGNLLTVE EEKKRRSLEL IPLTARMVMA HLVNHLGHYP LSGGPAILHS
1410 1420 1430 1440 1450
LVSENHDNAH VEGSELSFEV FRSPNLQLFV FNDSTLISYL QTPTEGPVGG
1460 1470 1480 1490 1500
SPVGSLSDVR VIVRDISGKY SWDGKVLYGP LEGCLAPNGR NPSFLISSWH
1510 1520 1530 1540 1550
RDTFGPQKDS SQVEEGDDVL DKLLENIGHT SPECLLPSQL NLNEPSLTPC
1560 1570 1580 1590 1600
GMNYDQEKEI IEVILRQNAQ EDEYIQSHNF DSAMKVTSQG QPSPVEPRGP
1610 1620 1630 1640 1650
FYFCRLLLDD LGMNSWDRRK NFHLLKKNSK LLRELKNLDS RQCRETHKIA
1660 1670 1680 1690 1700
VFYIAEGQED KCSILSNERG SQAYEDFVAG LGWEVDLSTH CGFMGGLQRN
1710 1720 1730 1740 1750
GSTGQTAPYY ATSTVEVIFH VSTRMPSDSD DSLTKKLRHL GNDEVHIVWS
1760 1770 1780 1790 1800
EHSRDYRRGI IPTAFGDVSI IIYPMKNHMF FIAITKKPEV PFFGPLFDGA
1810 1820 1830 1840 1850
IVSGKLLPSL VCATCINASR AVKCLIPLYQ SFYEERALYL EAIIQNHREV
1860 1870
MTFEDFAAQV FSPSPSYSLS GTD
Length:1,873
Mass (Da):210,770
Last modified:May 15, 2007 - v2
Checksum:iDC33C087B4802541
GO
Isoform 2 (identifier: Q2PPJ7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1832-1873: FYEERALYLEAIIQNHREVMTFEDFAAQVFSPSPSYSLSGTD → LYLFALNV

Show »
Length:1,839
Mass (Da):206,862
Checksum:i9A546D26DD09D1B9
GO
Isoform 3 (identifier: Q2PPJ7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1832-1873: FYEERALYLEAIIQNHREVMTFEDFAAQVFSPSPSYSLSGTD → PRVR

Show »
Length:1,835
Mass (Da):206,436
Checksum:i10DC3EF9E46D8382
GO

Sequence cautioni

The sequence AAH13749 differs from that shown. Reason: Frameshift at positions 1600 and 1843.Curated
The sequence BAB14290 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAI39939 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAI40814 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAI95626 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1488N → S in ABC33805 (PubMed:16490346).Curated1
Sequence conflicti1488N → S in BAA86586 (PubMed:10574462).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_049157492S → N. Corresponds to variant dbSNP:rs6137081Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0252471832 – 1873FYEER…LSGTD → LYLFALNV in isoform 2. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_0252481832 – 1873FYEER…LSGTD → PRVR in isoform 3. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ310704 mRNA Translation: ABC33805.1
AL157718, AL078634 Genomic DNA Translation: CAI12810.1
AL161658, AL078634, AL121896 Genomic DNA Translation: CAI40814.1 Sequence problems.
AL161658, AL121896 Genomic DNA Translation: CAI40815.1
AL078634, AL157718 Genomic DNA Translation: CAI95625.1
AL078634, AL121896, AL161658 Genomic DNA Translation: CAI95626.1 Sequence problems.
AL078634 Genomic DNA Translation: CAI95627.1
AL121896, AL078634, AL161658 Genomic DNA Translation: CAI39939.1 Sequence problems.
AL121896, AL161658 Genomic DNA Translation: CAI39940.1
AL121896 Genomic DNA Translation: CAC27348.1
AB033098 mRNA Translation: BAA86586.1
AK022881 mRNA Translation: BAB14290.1 Different initiation.
BC013749 mRNA Translation: AAH13749.1 Frameshift.
CCDSiCCDS46584.1 [Q2PPJ7-1]
RefSeqiNP_065076.2, NM_020343.3 [Q2PPJ7-1]
UniGeneiHs.472285

Genome annotation databases

EnsembliENST00000202677; ENSP00000202677; ENSG00000188559 [Q2PPJ7-1]
GeneIDi57186
KEGGihsa:57186
UCSCiuc002wrz.4 human [Q2PPJ7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiRGPA2_HUMAN
AccessioniPrimary (citable) accession number: Q2PPJ7
Secondary accession number(s): Q4VXU6
, Q5JUA3, Q5JUA4, Q5T9K3, Q96CX9, Q9BQT7, Q9H9D9, Q9ULE8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: May 15, 2007
Last modified: June 20, 2018
This is version 107 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health