Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

PH and SEC7 domain-containing protein 3

Gene

Psd3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Guanine nucleotide exchange factor for ARF6.1 Publication

GO - Molecular functioni

  • ARF guanyl-nucleotide exchange factor activity Source: MGI

GO - Biological processi

  • ARF protein signal transduction Source: MGI
  • regulation of ARF protein signal transduction Source: InterPro

Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Names & Taxonomyi

Protein namesi
Recommended name:
PH and SEC7 domain-containing protein 3
Alternative name(s):
Exchange factor for ADP-ribosylation factor guanine nucleotide factor 6 D
Short name:
Exchange factor for ARF6 D
Pleckstrin homology and SEC7 domain-containing protein 3
Gene namesi
Name:Psd3
Synonyms:Efa6d1 Publication, Kiaa0942
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:1918215 Psd3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane, Postsynaptic cell membrane, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003094541 – 1037PH and SEC7 domain-containing protein 3Add BLAST1037

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei76PhosphoserineBy similarity1
Modified residuei759PhosphoserineCombined sources1
Modified residuei998PhosphoserineCombined sources1
Modified residuei1000PhosphoserineCombined sources1
Modified residuei1001PhosphoserineCombined sources1
Modified residuei1003PhosphoserineCombined sources1
Modified residuei1009PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ2PFD7
PaxDbiQ2PFD7
PeptideAtlasiQ2PFD7
PRIDEiQ2PFD7

PTM databases

iPTMnetiQ2PFD7
PhosphoSitePlusiQ2PFD7
SwissPalmiQ2PFD7

Expressioni

Tissue specificityi

Ubiquitously expressed, with highest levels in liver. Present in brain, with highest levels in olfactory bulb, cortex, hippocampal pyramidal cell layer and cerebellar granule cell layer (at protein level).1 Publication

Developmental stagei

Expressed only in spinal cord at E13. At E18 and P0, appears weakly in forebrain. Expression in brain increases after birth and peaks at P10.1 Publication

Gene expression databases

BgeeiENSMUSG00000030465 Expressed in 256 organ(s), highest expression level in subiculum
CleanExiMM_PSD3
ExpressionAtlasiQ2PFD7 baseline and differential
GenevisibleiQ2PFD7 MM

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi231513, 1 interactor
CORUMiQ2PFD7
STRINGi10090.ENSMUSP00000096293

Structurei

3D structure databases

ProteinModelPortaliQ2PFD7
SMRiQ2PFD7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini515 – 723SEC7PROSITE-ProRule annotationAdd BLAST209
Domaini774 – 887PHPROSITE-ProRule annotationAdd BLAST114

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili911 – 941Sequence analysisAdd BLAST31

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0932 Eukaryota
COG5307 LUCA
GeneTreeiENSGT00920000149004
HOGENOMiHOG000115732
HOVERGENiHBG108299
InParanoidiQ2PFD7
KOiK12494
OMAiMRKCCMD
PhylomeDBiQ2PFD7
TreeFamiTF319755

Family and domain databases

CDDicd00171 Sec7, 1 hit
Gene3Di1.10.1000.11, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR023394 Sec7_C_sf
IPR000904 Sec7_dom
IPR035999 Sec7_dom_sf
PfamiView protein in Pfam
PF01369 Sec7, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00222 Sec7, 1 hit
SUPFAMiSSF48425 SSF48425, 1 hit
PROSITEiView protein in PROSITE
PS50003 PH_DOMAIN, 1 hit
PS50190 SEC7, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q2PFD7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEGRNAAAEP FVWVNSASAH SQSVAKAKYE FLFGKSEEKT PDSSDHGGST
60 70 80 90 100
LLPPTVTNEF PEYGTMEEGG EGLRASLDFD AKSPPCRLPG QQAVHLLAGQ
110 120 130 140 150
DSILNSVTEG PNDAPQCHPQ EQSLQPIDSL ISALKATEAR IASGTFQATK
160 170 180 190 200
VLDKDANFSV YQVDKELSTA SHKPQRAHRT FPVGPGKSPD IPLSAEVPTE
210 220 230 240 250
ENLSLHIQED LSALLPEEAQ AHRSQITNYR RQGPLRVPES ACPVSSSSAG
260 270 280 290 300
SHNPVDRVGA LREQRSDLGR EHPRGYDRGG SMGRQGRIKH VEFQGVEILW
310 320 330 340 350
TGEEAESRHP PERTASPVSK EFAKRPSHSS PACGVCSTST HLTGDVWDET
360 370 380 390 400
CKAPSERPGT SAGTLSPMPL GESGEDDVFL RESKEHLEEN FAIQGDKERI
410 420 430 440 450
LDQEEHLRGD DDILGPGYTE DSTDVYSSQF ETILDNTSLY YSAESLETLY
460 470 480 490 500
SEPDSYFSFE MPLTPMIQQR IKEGGQFLER TSVGGQHDVL SVSADGGIVM
510 520 530 540 550
GYSAGITNGL HDSANSVYTR GPQEIAFWGS RDRCFAEGKT TGVDAGSEMG
560 570 580 590 600
STDILEKETT ESLSNGTNSN VEAAKRLAKR LYHLDRFKRS DVAKHLGKNN
610 620 630 640 650
EFSKLVAEEY LKFFDFTGMT LDQSLRYFLK AFSLVGETQE RERVLIHFSN
660 670 680 690 700
RYFSCNPDTI TSKDGVHCLT CAMMLLNTDL HGHVNIGKKM TCQEFITNLQ
710 720 730 740 750
GVNEGGDFSK DLLKALYNSI KNEKLEWAVD DEEKKKSPSE GTDEKANGTH
760 770 780 790 800
PKTISRIGST TNPFLDIPHD PNAAVYKSGF LARKIHADMD GKKTPRGKRG
810 820 830 840 850
WKTFYAVLKG TVLYLQKDEY KPEKSLSDED LKNAVSVHHA LASKATDYEK
860 870 880 890 900
KPNVFKLKTA DWRVLLFQTQ SPEEMQGWIN KINCVAAVFS APPFPAAIGS
910 920 930 940 950
QKKFSRPLLP ATTTKLSQEE QLKSHESKLK QITTELAEHR SYPPDKKVKA
960 970 980 990 1000
KDVDEYKLKD HYLEFEKTRY EIYVSVLKEG GKELLTTDGN EPVGLKKSHS
1010 1020 1030
SPSLNPDASP VTAKVKRNVS ERKDHRPETP GIKQKVT
Length:1,037
Mass (Da):114,722
Last modified:November 13, 2007 - v2
Checksum:iE6E3C240AC7A61E8
GO
Isoform 2 (identifier: Q2PFD7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     684-684: Missing.

Show »
Length:1,036
Mass (Da):114,623
Checksum:i34FF9E2E43BAB2F8
GO
Isoform 3 (identifier: Q2PFD7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-518: Missing.
     519-530: TRGPQEIAFWGS → MGIIMCLIYCYC
     684-684: Missing.

Show »
Length:518
Mass (Da):58,467
Checksum:iE91589D1EF9433AF
GO
Isoform 4 (identifier: Q2PFD7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     919-966: Missing.

Show »
Length:989
Mass (Da):108,938
Checksum:i42D40BEF95E68601
GO
Isoform 5 (identifier: Q2PFD7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-44: MEGRNAAAEPFVWVNSASAHSQSVAKAKYEFLFGKSEEKTPDSS → MGNCWSYSNLC

Show »
Length:1,004
Mass (Da):111,209
Checksum:iFDD14383335B19FB
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PUC5E9PUC5_MOUSE
PH and SEC7 domain-containing prote...
Psd3
376Annotation score:
F6Z9E6F6Z9E6_MOUSE
PH and SEC7 domain-containing prote...
Psd3
1,005Annotation score:
Q8C0E9Q8C0E9_MOUSE
PH and SEC7 domain-containing prote...
Psd3
390Annotation score:
A0A1D5RMH7A0A1D5RMH7_MOUSE
PH and SEC7 domain-containing prote...
Psd3
1,289Annotation score:
A0A1D5RLK2A0A1D5RLK2_MOUSE
PH and SEC7 domain-containing prote...
Psd3
1,035Annotation score:
A0A1D5RLM2A0A1D5RLM2_MOUSE
PH and SEC7 domain-containing prote...
Psd3
276Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti190D → E in BAC26065 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0291571 – 518Missing in isoform 3. 1 PublicationAdd BLAST518
Alternative sequenceiVSP_0291581 – 44MEGRN…TPDSS → MGNCWSYSNLC in isoform 5. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_029159519 – 530TRGPQ…AFWGS → MGIIMCLIYCYC in isoform 3. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_029160684Missing in isoform 3 and isoform 2. 1 Publication1
Alternative sequenceiVSP_029161919 – 966Missing in isoform 4. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB220685 mRNA Translation: BAE73186.1
AK028684 mRNA Translation: BAC26065.1
AK161498 mRNA Translation: BAE36424.1
AK122405 mRNA Translation: BAC65687.1
BC042208 mRNA Translation: AAH42208.1
CCDSiCCDS22340.1 [Q2PFD7-3]
CCDS40355.2 [Q2PFD7-5]
RefSeqiNP_081902.1, NM_027626.1
NP_084539.2, NM_030263.5 [Q2PFD7-3]
NP_808366.2, NM_177698.4 [Q2PFD7-5]
XP_017168191.1, XM_017312702.1 [Q2PFD7-2]
UniGeneiMm.32525

Genome annotation databases

EnsembliENSMUST00000093468; ENSMUSP00000091178; ENSMUSG00000030465 [Q2PFD7-3]
ENSMUST00000093469; ENSMUSP00000091179; ENSMUSG00000030465 [Q2PFD7-5]
ENSMUST00000098696; ENSMUSP00000096293; ENSMUSG00000030465 [Q2PFD7-5]
GeneIDi234353
KEGGimmu:234353
UCSCiuc009lvz.2 mouse [Q2PFD7-3]
uc009lwc.1 mouse [Q2PFD7-2]
uc057alt.1 mouse [Q2PFD7-5]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB220685 mRNA Translation: BAE73186.1
AK028684 mRNA Translation: BAC26065.1
AK161498 mRNA Translation: BAE36424.1
AK122405 mRNA Translation: BAC65687.1
BC042208 mRNA Translation: AAH42208.1
CCDSiCCDS22340.1 [Q2PFD7-3]
CCDS40355.2 [Q2PFD7-5]
RefSeqiNP_081902.1, NM_027626.1
NP_084539.2, NM_030263.5 [Q2PFD7-3]
NP_808366.2, NM_177698.4 [Q2PFD7-5]
XP_017168191.1, XM_017312702.1 [Q2PFD7-2]
UniGeneiMm.32525

3D structure databases

ProteinModelPortaliQ2PFD7
SMRiQ2PFD7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi231513, 1 interactor
CORUMiQ2PFD7
STRINGi10090.ENSMUSP00000096293

PTM databases

iPTMnetiQ2PFD7
PhosphoSitePlusiQ2PFD7
SwissPalmiQ2PFD7

Proteomic databases

MaxQBiQ2PFD7
PaxDbiQ2PFD7
PeptideAtlasiQ2PFD7
PRIDEiQ2PFD7

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000093468; ENSMUSP00000091178; ENSMUSG00000030465 [Q2PFD7-3]
ENSMUST00000093469; ENSMUSP00000091179; ENSMUSG00000030465 [Q2PFD7-5]
ENSMUST00000098696; ENSMUSP00000096293; ENSMUSG00000030465 [Q2PFD7-5]
GeneIDi234353
KEGGimmu:234353
UCSCiuc009lvz.2 mouse [Q2PFD7-3]
uc009lwc.1 mouse [Q2PFD7-2]
uc057alt.1 mouse [Q2PFD7-5]

Organism-specific databases

CTDi23362
MGIiMGI:1918215 Psd3
RougeiSearch...

Phylogenomic databases

eggNOGiKOG0932 Eukaryota
COG5307 LUCA
GeneTreeiENSGT00920000149004
HOGENOMiHOG000115732
HOVERGENiHBG108299
InParanoidiQ2PFD7
KOiK12494
OMAiMRKCCMD
PhylomeDBiQ2PFD7
TreeFamiTF319755

Miscellaneous databases

ChiTaRSiPsmd3 mouse
PROiPR:Q2PFD7
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000030465 Expressed in 256 organ(s), highest expression level in subiculum
CleanExiMM_PSD3
ExpressionAtlasiQ2PFD7 baseline and differential
GenevisibleiQ2PFD7 MM

Family and domain databases

CDDicd00171 Sec7, 1 hit
Gene3Di1.10.1000.11, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR023394 Sec7_C_sf
IPR000904 Sec7_dom
IPR035999 Sec7_dom_sf
PfamiView protein in Pfam
PF01369 Sec7, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00222 Sec7, 1 hit
SUPFAMiSSF48425 SSF48425, 1 hit
PROSITEiView protein in PROSITE
PS50003 PH_DOMAIN, 1 hit
PS50190 SEC7, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPSD3_MOUSE
AccessioniPrimary (citable) accession number: Q2PFD7
Secondary accession number(s): Q3TTA1
, Q80TN6, Q80UZ7, Q8CEA6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: November 7, 2018
This is version 111 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again