Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 110 (31 Jul 2019)
Sequence version 2 (04 Apr 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Tectonic-1

Gene

TCTN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Regulator of Hedgehog (Hh), required for both activation and inhibition of the Hh pathway in the patterning of the neural tube. During neural tube development, it is required for formation of the most ventral cell types and for full Hh pathway activation. Functions in Hh signal transduction to fully activate the pathway in the presence of high Hh levels and to repress the pathway in the absence of Hh signals. Modulates Hh signal transduction downstream of SMO and RAB23 (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processCilium biogenesis/degradation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5620912 Anchoring of the basal body to the plasma membrane

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tectonic-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TCTN1
Synonyms:TECT1
ORF Names:UNQ9369/PRO34160
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26113 TCTN1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609863 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q2MV58

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Joubert syndrome 13 (JBTS13)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder presenting with cerebellar ataxia, oculomotor apraxia, hypotonia, neonatal breathing abnormalities and psychomotor delay. Neuroradiologically, it is characterized by cerebellar vermian hypoplasia/aplasia, thickened and reoriented superior cerebellar peduncles, and an abnormally large interpeduncular fossa, giving the appearance of a molar tooth on transaxial slices (molar tooth sign). Additional variable features include retinal dystrophy and renal disease.
Related information in OMIM

Keywords - Diseasei

Ciliopathy, Joubert syndrome

Organism-specific databases

DisGeNET

More...
DisGeNETi
79600

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
TCTN1

MalaCards human disease database

More...
MalaCardsi
TCTN1
MIMi614173 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000204852

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
475 Joubert syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162405437

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TCTN1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
91208022

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 22Sequence analysisAdd BLAST22
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000022979623 – 587Tectonic-1Add BLAST565

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi36N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi295N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi528N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q2MV58

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q2MV58

PeptideAtlas

More...
PeptideAtlasi
Q2MV58

PRoteomics IDEntifications database

More...
PRIDEi
Q2MV58

ProteomicsDB human proteome resource

More...
ProteomicsDBi
61399 [Q2MV58-1]
61400 [Q2MV58-2]
61401 [Q2MV58-3]
61402 [Q2MV58-4]
61403 [Q2MV58-5]
61404 [Q2MV58-6]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q2MV58-2 [Q2MV58-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q2MV58

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q2MV58

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000204852 Expressed in 172 organ(s), highest expression level in right uterine tube

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q2MV58 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q2MV58 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA039687
HPA040036

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Part of the tectonic-like complex (also named B9 complex).

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122738, 133 interactors

Protein interaction database and analysis system

More...
IntActi
Q2MV58, 100 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000380779

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi78 – 97Cys-richAdd BLAST20

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the tectonic family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IFF2 Eukaryota
ENOG411028N LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00570000079101

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q2MV58

KEGG Orthology (KO)

More...
KOi
K19382

Identification of Orthologs from Complete Genome Data

More...
OMAi
PTINAKL

Database of Orthologous Groups

More...
OrthoDBi
446525at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q2MV58

TreeFam database of animal gene trees

More...
TreeFami
TF329169

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011677 DUF1619
IPR040354 Tectonic

The PANTHER Classification System

More...
PANTHERi
PTHR14611 PTHR14611, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07773 DUF1619, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 13 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q2MV58-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRPRGLPPLL VVLLGCWASV SAQTDATPAV TTEGLNSTEA ALATFGTFPS
60 70 80 90 100
TRPPGTPRAP GPSSGPRPTP VTDVAVLCVC DLSPAQCDIN CCCDPDCSSV
110 120 130 140 150
DFSVFSACSV PVVTGDSQFC SQKAVIYSLN FTANPPQRVF ELVDQINPSI
160 170 180 190 200
FCIHITNYKP ALSFINPEVP DENNFDTLMK TSDGFTLNAE SYVSFTTKLD
210 220 230 240 250
IPTAAKYEYG VPLQTSDSFL RFPSSLTSSL CTDNNPAAFL VNQAVKCTRK
260 270 280 290 300
INLEQCEEIE ALSMAFYSSP EILRVPDSRK KVPITVQSIV IQSLNKTLTR
310 320 330 340 350
REDTDVLQPT LVNAGHFSLC VNVVLEVKYS LTYTDAGEVT KADLSFVLGT
360 370 380 390 400
VSSVVVPLQQ KFEIHFLQEN TQPVPLSGNP GYVVGLPLAA GFQPHKGSGI
410 420 430 440 450
IQTTNRYGQL TILHSTTEQD CLALEGVRTP VLFGYTMQSG CKLRLTGALP
460 470 480 490 500
CQLVAQKVKS LLWGQGFPDY VAPFGNSQAQ DMLDWVPIHF ITQSFNRKDS
510 520 530 540 550
CQLPGALVIE VKWTKYGSLL NPQAKIVNVT ANLISSSFPE ANSGNERTIL
560 570 580
ISTAVTFVDV SAPAEAGFRA PPAINARLPF NFFFPFV
Length:587
Mass (Da):63,570
Last modified:April 4, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0FFAD006E3B9160D
GO
Isoform 2 (identifier: Q2MV58-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     498-498: K → KHFVLQ

Show »
Length:592
Mass (Da):64,194
Checksum:i7A7452307CFF9844
GO
Isoform 3 (identifier: Q2MV58-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     238-274: AFLVNQAVKCTRKINLEQCEEIEALSMAFYSSPEILR → GQAYWFTPVIPALWEAEARGSLE

Show »
Length:573
Mass (Da):61,916
Checksum:i8D6DE4B551763306
GO
Isoform 4 (identifier: Q2MV58-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-73: MRPRGLPPLL...SGPRPTPVTD → MCQLLESTVIQPQGDSP

Show »
Length:531
Mass (Da):58,018
Checksum:i18BBEC27ECCE3B12
GO
Isoform 5 (identifier: Q2MV58-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-73: MRPRGLPPLL...SGPRPTPVTD → MITAHCGLDLLGS
     398-446: Missing.
     498-498: K → KHFVLQ

Show »
Length:483
Mass (Da):52,729
Checksum:iBF71AD96270313DB
GO
Isoform 6 (identifier: Q2MV58-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-178: Missing.
     369-438: ENTQPVPLSG...TPVLFGYTMQ → TDWSSPVSAR...RGFGYRSEVD
     439-587: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.
Show »
Length:260
Mass (Da):28,532
Checksum:i6396F9FB6AE91F2C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 13 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B4DIB9B4DIB9_HUMAN
Tectonic-1
TCTN1
245Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PNE4E9PNE4_HUMAN
Tectonic-1
TCTN1
263Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PR69E9PR69_HUMAN
Tectonic-1
TCTN1
83Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KPW2J3KPW2_HUMAN
Tectonic-1
TCTN1
179Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R339S4R339_HUMAN
Tectonic-1
TCTN1
162Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3M8S4R3M8_HUMAN
Tectonic-1
TCTN1
75Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R3G2S4R3G2_HUMAN
Tectonic-1
TCTN1
106Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X1J4A0A087X1J4_HUMAN
Tectonic-1
TCTN1
573Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PIB8E9PIB8_HUMAN
Tectonic-1
TCTN1
100Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
S4R2Y1S4R2Y1_HUMAN
Tectonic-1
TCTN1
88Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti14L → M in AAQ88551 (PubMed:12975309).Curated1
Sequence conflicti330S → T in ABB90560 (PubMed:16357211).Curated1
Sequence conflicti341K → E in BAB15000 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0177561 – 178Missing in isoform 6. 1 PublicationAdd BLAST178
Alternative sequenceiVSP_0177571 – 73MRPRG…TPVTD → MCQLLESTVIQPQGDSP in isoform 4. 1 PublicationAdd BLAST73
Alternative sequenceiVSP_0177581 – 73MRPRG…TPVTD → MITAHCGLDLLGS in isoform 5. 1 PublicationAdd BLAST73
Alternative sequenceiVSP_017759238 – 274AFLVN…PEILR → GQAYWFTPVIPALWEAEARG SLE in isoform 3. 2 PublicationsAdd BLAST37
Alternative sequenceiVSP_017760369 – 438ENTQP…GYTMQ → TDWSSPVSARSTEGEEPAVG PGLPRLRGPFWKFPGPGHAG LGAHPLHHPVIQQEGFLPAP RGFGYRSEVD in isoform 6. 1 PublicationAdd BLAST70
Alternative sequenceiVSP_017761398 – 446Missing in isoform 5. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_017762439 – 587Missing in isoform 6. 1 PublicationAdd BLAST149
Alternative sequenceiVSP_017763498K → KHFVLQ in isoform 2 and isoform 5. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ278868 mRNA Translation: ABB90560.1
AY358184 mRNA Translation: AAQ88551.1
AK024780 mRNA Translation: BAB15000.1
AK055891 mRNA Translation: BAB71036.1
AK092775 mRNA Translation: BAC03973.1
AC002350 Genomic DNA No translation available.
AC144522 Genomic DNA No translation available.
BC040113 mRNA Translation: AAH40113.1
BC044885 mRNA No translation available.
BC062611 mRNA Translation: AAH62611.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41833.1 [Q2MV58-3]
CCDS41834.1 [Q2MV58-2]
CCDS41835.1 [Q2MV58-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001076006.1, NM_001082537.2 [Q2MV58-1]
NP_001076007.1, NM_001082538.2 [Q2MV58-2]
NP_001167446.1, NM_001173975.2 [Q2MV58-4]
NP_001167447.1, NM_001173976.1
NP_078825.2, NM_024549.5 [Q2MV58-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000397655; ENSP00000380775; ENSG00000204852 [Q2MV58-3]
ENST00000397659; ENSP00000380779; ENSG00000204852 [Q2MV58-2]
ENST00000551590; ENSP00000448735; ENSG00000204852 [Q2MV58-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79600

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79600

UCSC genome browser

More...
UCSCi
uc001trn.6 human [Q2MV58-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ278868 mRNA Translation: ABB90560.1
AY358184 mRNA Translation: AAQ88551.1
AK024780 mRNA Translation: BAB15000.1
AK055891 mRNA Translation: BAB71036.1
AK092775 mRNA Translation: BAC03973.1
AC002350 Genomic DNA No translation available.
AC144522 Genomic DNA No translation available.
BC040113 mRNA Translation: AAH40113.1
BC044885 mRNA No translation available.
BC062611 mRNA Translation: AAH62611.1
CCDSiCCDS41833.1 [Q2MV58-3]
CCDS41834.1 [Q2MV58-2]
CCDS41835.1 [Q2MV58-1]
RefSeqiNP_001076006.1, NM_001082537.2 [Q2MV58-1]
NP_001076007.1, NM_001082538.2 [Q2MV58-2]
NP_001167446.1, NM_001173975.2 [Q2MV58-4]
NP_001167447.1, NM_001173976.1
NP_078825.2, NM_024549.5 [Q2MV58-3]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi122738, 133 interactors
IntActiQ2MV58, 100 interactors
STRINGi9606.ENSP00000380779

PTM databases

iPTMnetiQ2MV58
PhosphoSitePlusiQ2MV58

Polymorphism and mutation databases

BioMutaiTCTN1
DMDMi91208022

Proteomic databases

MaxQBiQ2MV58
PaxDbiQ2MV58
PeptideAtlasiQ2MV58
PRIDEiQ2MV58
ProteomicsDBi61399 [Q2MV58-1]
61400 [Q2MV58-2]
61401 [Q2MV58-3]
61402 [Q2MV58-4]
61403 [Q2MV58-5]
61404 [Q2MV58-6]
TopDownProteomicsiQ2MV58-2 [Q2MV58-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000397655; ENSP00000380775; ENSG00000204852 [Q2MV58-3]
ENST00000397659; ENSP00000380779; ENSG00000204852 [Q2MV58-2]
ENST00000551590; ENSP00000448735; ENSG00000204852 [Q2MV58-1]
GeneIDi79600
KEGGihsa:79600
UCSCiuc001trn.6 human [Q2MV58-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79600
DisGeNETi79600

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TCTN1
GeneReviewsiTCTN1
HGNCiHGNC:26113 TCTN1
HPAiHPA039687
HPA040036
MalaCardsiTCTN1
MIMi609863 gene
614173 phenotype
neXtProtiNX_Q2MV58
OpenTargetsiENSG00000204852
Orphaneti475 Joubert syndrome
PharmGKBiPA162405437

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IFF2 Eukaryota
ENOG411028N LUCA
GeneTreeiENSGT00570000079101
InParanoidiQ2MV58
KOiK19382
OMAiPTINAKL
OrthoDBi446525at2759
PhylomeDBiQ2MV58
TreeFamiTF329169

Enzyme and pathway databases

ReactomeiR-HSA-5620912 Anchoring of the basal body to the plasma membrane

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79600

Protein Ontology

More...
PROi
PR:Q2MV58

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000204852 Expressed in 172 organ(s), highest expression level in right uterine tube
ExpressionAtlasiQ2MV58 baseline and differential
GenevisibleiQ2MV58 HS

Family and domain databases

InterProiView protein in InterPro
IPR011677 DUF1619
IPR040354 Tectonic
PANTHERiPTHR14611 PTHR14611, 1 hit
PfamiView protein in Pfam
PF07773 DUF1619, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTECT1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q2MV58
Secondary accession number(s): A8MX11
, Q49A60, Q6P5X1, Q6UXW2, Q8NAE9, Q96N72, Q9H798
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 4, 2006
Last sequence update: April 4, 2006
Last modified: July 31, 2019
This is version 110 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again