Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 111 (07 Apr 2021)
Sequence version 1 (21 Feb 2006)
Previous versions | rss
Add a publicationFeedback
Protein

Phosphatase and actin regulator 1

Gene

Phactr1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds actin monomers (G actin) and plays a role in multiple processes including the regulation of actin cytoskeleton dynamics, actin stress fibers formation, cell motility and survival, formation of tubules by endothelial cells, and regulation of PPP1CA activity. Involved in the regulation of cortical neuron migration and dendrite arborization (PubMed:30256902).By similarity3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, Protein phosphatase inhibitor

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phosphatase and actin regulator 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Phactr1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2659021, Phactr1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell junction, Cytoplasm, Nucleus, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

PHACTR1 knockdown results in migration defects of cortical neurons. Neurons do not migrate to layers II-IV of the cortical plate but remain in the lower part and the intermediate zone.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi108 – 110RRR → AAA: Abolishes nuclear import. 3
Mutagenesisi127 – 129KKK → AAA: Abolishes nuclear import. 3
Mutagenesisi147R → A: Reduces affinity for actin. 1 Publication1
Mutagenesisi431R → A: Constitutively nuclear; when associated with A-469 and A-507. Strongly reduced affinity for actin. 1 Publication1
Mutagenesisi459G → K: Increases affinity for actin. 1 Publication1
Mutagenesisi469R → A: Constitutively nuclear; when associated with A-431 and A-507. Strongly reduced affinity for actin. 1 Publication1
Mutagenesisi479N → I: Does not rescue cortical neuron migration defects in PHACTR1 knocked-down mice. 1 Publication1
Mutagenesisi496I → A: Reduces affinity for actin. 1 Publication1
Mutagenesisi500L → P: Does not rescue cortical neuron migration defects in PHACTR1 knocked-down mice. 1 Publication1
Mutagenesisi507R → A: Constitutively nuclear; when associated with A-431 and A-469. Strongly reduced affinity for actin. 1 Publication1
Mutagenesisi516R → A: Reduces affinity for actin. 1 Publication1
Mutagenesisi518I → N: Does not rescue cortical neuron migration defects in PHACTR1 knocked-down mice. 1 Publication1
Mutagenesisi521R → C: Does not rescue cortical neuron migration defects in PHACTR1 knocked-down mice. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002359901 – 580Phosphatase and actin regulator 1Add BLAST580

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei67PhosphoserineCombined sources1
Modified residuei78PhosphoserineCombined sources1
Modified residuei104PhosphothreonineCombined sources1
Modified residuei467PhosphoserineBy similarity1
Modified residuei505PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q2M3X8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q2M3X8

PeptideAtlas

More...
PeptideAtlasi
Q2M3X8

PRoteomics IDEntifications database

More...
PRIDEi
Q2M3X8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
289484 [Q2M3X8-1]
289485 [Q2M3X8-2]
289486 [Q2M3X8-3]
289487 [Q2M3X8-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q2M3X8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q2M3X8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000054728, Expressed in dorsal striatum and 261 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q2M3X8, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via RPEL repeats) with ACTA1 and PPP1CA; ACTA1 and PPP1CA compete for the same binding site.

2 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
229998, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q2M3X8, 3 interactors

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q2M3X8, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1580
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q2M3X8

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati138 – 163RPEL 1Add BLAST26
Repeati422 – 447RPEL 2Add BLAST26
Repeati460 – 485RPEL 3Add BLAST26
Repeati498 – 523RPEL 4Add BLAST26

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi108 – 129Nuclear localization signalAdd BLAST22

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi395 – 403Poly-Glu9

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Binds three actin monomers via the three C-terminal RPEL repeats.1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155842

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_015753_3_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q2M3X8

Identification of Orthologs from Complete Genome Data

More...
OMAi
TQHHHTV

Database of Orthologous Groups

More...
OrthoDBi
1205245at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q2M3X8

TreeFam database of animal gene trees

More...
TreeFami
TF316316

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029987, Phactr1
IPR004018, RPEL_repeat

The PANTHER Classification System

More...
PANTHERi
PTHR12751:SF6, PTHR12751:SF6, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02755, RPEL, 4 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00707, RPEL, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51073, RPEL, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q2M3X8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDYPKMDYFL DVESAHRLLD VESAQRFFYS QGAQARRATL LLPPTLMAAS
60 70 80 90 100
SEDDIDRRPI RRVRSKSDTP YLAEARISFN LGAAEEVERL AAMRSDSLVP
110 120 130 140 150
GTHTPPIRRR SKFANLGRIF KPWKWRKKKS EKFKHTSAAL ERKISMRQSR
160 170 180 190 200
EELIKRGVLK EIYDKDGELS ISNEDDSLEN GQSLSSSQLS LPALSEMEPV
210 220 230 240 250
PMPRDPCSYE VLQASDIMDG PDPGAPVKLP CLPVKLSPPL PPKKVLICMP
260 270 280 290 300
VGGPELTLAS YAAQKSSQQA VAQHHHTVLP SQMQHQLQYG SHGQHLPSST
310 320 330 340 350
GTLPMHPSGC RMIDELNKTL AMTMQRLESS EQRVPCSTSY HSSGLHSSDG
360 370 380 390 400
ITKAGPMGLP EIRQVPTVVI ECDDNKENVP HEPDYEDSPC LYGREEEEEE
410 420 430 440 450
EDEDDDASLY TSSLAMKVCR KDSLAIKLSN RPSKRELEEK NILPRQTDEE
460 470 480 490 500
RLELRQQIGT KLTRRLSQRP TAEELEQRNI LKPRNEQEEQ EEKREIKRRL
510 520 530 540 550
TRKLSQRPTV EELRERKILI RFSDYVEVAD AQDYDRRADK PWTRLTAADK
560 570 580
AAIRKELNEF KSTEMEVHEL SRHLTRFHRP
Length:580
Mass (Da):66,286
Last modified:February 21, 2006 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i367DD2393117EC89
GO
Isoform 2 (identifier: Q2M3X8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MDYPKMDYFLDVESAHRLLDVESAQRFFYSQGAQ → MCVSLLLSPPPPFRLSPSPSLHLLLLS

Show »
Length:573
Mass (Da):65,143
Checksum:i077C19321C16FE26
GO
Isoform 3 (identifier: Q2M3X8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MDYPKMDYFLDVESAHRLLDVESAQRFFYSQGAQ → MCVSLLLSPPPPFRLSPSPSLHLLLLS
     221-221: P → PVSEESPSASESGVLLSQDPSAKPVLFLPPKKSAAFPGDHEETPVKQLSLHKQPPALPPKPTARIANHLT

Show »
Length:642
Mass (Da):72,427
Checksum:i825EA76DBE9A8CD2
GO
Isoform 4 (identifier: Q2M3X8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     221-221: P → PVSEESPSASESGVLLSQDPSAKPVLFLPPKKSAAFPGDHEETPVKQLSLHKQPPALPPKPTARIANHLT

Show »
Length:649
Mass (Da):73,570
Checksum:i05238060A2217537
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1B1B8B1B1B8_MOUSE
Phosphatase and actin regulator
Phactr1
557Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A668KL56A0A668KL56_MOUSE
Phosphatase and actin regulator
Phactr1
205Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F8MPG5A0A5F8MPG5_MOUSE
Phosphatase and actin regulator
Phactr1
124Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F8MPI2A0A5F8MPI2_MOUSE
Phosphatase and actin regulator
Phactr1
128Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH48407 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAH61691 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAC33272 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0185591 – 34MDYPK…SQGAQ → MCVSLLLSPPPPFRLSPSPS LHLLLLS in isoform 2 and isoform 3. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_018560221P → PVSEESPSASESGVLLSQDP SAKPVLFLPPKKSAAFPGDH EETPVKQLSLHKQPPALPPK PTARIANHLT in isoform 3 and isoform 4. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY993932 mRNA Translation: AAY42814.1
AC140415 Genomic DNA No translation available.
AC154505 Genomic DNA No translation available.
AC164878 Genomic DNA No translation available.
CT025549 Genomic DNA No translation available.
CH466546 Genomic DNA Translation: EDL40986.1
BC048407 mRNA Translation: AAH48407.1 Different initiation.
BC061691 mRNA Translation: AAH61691.1 Different initiation.
AK048208 mRNA Translation: BAC33272.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS49251.1 [Q2M3X8-3]
CCDS79181.1 [Q2M3X8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001005740.1, NM_001005740.1 [Q2M3X8-3]
NP_001289564.1, NM_001302635.1 [Q2M3X8-1]
NP_001289565.1, NM_001302636.1
XP_006516968.1, XM_006516905.3 [Q2M3X8-4]
XP_006516969.1, XM_006516906.3 [Q2M3X8-4]
XP_011242697.1, XM_011244395.2 [Q2M3X8-4]
XP_017170971.1, XM_017315482.1
XP_017170972.1, XM_017315483.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000066928; ENSMUSP00000066663; ENSMUSG00000054728 [Q2M3X8-2]
ENSMUST00000110161; ENSMUSP00000105790; ENSMUSG00000054728 [Q2M3X8-4]
ENSMUST00000128646; ENSMUSP00000122232; ENSMUSG00000054728 [Q2M3X8-1]
ENSMUST00000148891; ENSMUSP00000115228; ENSMUSG00000054728 [Q2M3X8-3]
ENSMUST00000149235; ENSMUSP00000115207; ENSMUSG00000054728 [Q2M3X8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
218194

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:218194

UCSC genome browser

More...
UCSCi
uc007qfo.2, mouse [Q2M3X8-1]
uc007qfp.1, mouse [Q2M3X8-3]
uc007qfq.1, mouse [Q2M3X8-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY993932 mRNA Translation: AAY42814.1
AC140415 Genomic DNA No translation available.
AC154505 Genomic DNA No translation available.
AC164878 Genomic DNA No translation available.
CT025549 Genomic DNA No translation available.
CH466546 Genomic DNA Translation: EDL40986.1
BC048407 mRNA Translation: AAH48407.1 Different initiation.
BC061691 mRNA Translation: AAH61691.1 Different initiation.
AK048208 mRNA Translation: BAC33272.1 Different initiation.
CCDSiCCDS49251.1 [Q2M3X8-3]
CCDS79181.1 [Q2M3X8-1]
RefSeqiNP_001005740.1, NM_001005740.1 [Q2M3X8-3]
NP_001289564.1, NM_001302635.1 [Q2M3X8-1]
NP_001289565.1, NM_001302636.1
XP_006516968.1, XM_006516905.3 [Q2M3X8-4]
XP_006516969.1, XM_006516906.3 [Q2M3X8-4]
XP_011242697.1, XM_011244395.2 [Q2M3X8-4]
XP_017170971.1, XM_017315482.1
XP_017170972.1, XM_017315483.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4B1UX-ray2.00M133-164[»]
4B1VX-ray1.75M/N133-164[»]
4B1WX-ray1.95M417-448[»]
4B1XX-ray1.80M455-486[»]
4B1YX-ray1.29M493-524[»]
4B1ZX-ray3.30M/N414-528[»]
SMRiQ2M3X8
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi229998, 5 interactors
IntActiQ2M3X8, 3 interactors

PTM databases

iPTMnetiQ2M3X8
PhosphoSitePlusiQ2M3X8

Proteomic databases

jPOSTiQ2M3X8
MaxQBiQ2M3X8
PeptideAtlasiQ2M3X8
PRIDEiQ2M3X8
ProteomicsDBi289484 [Q2M3X8-1]
289485 [Q2M3X8-2]
289486 [Q2M3X8-3]
289487 [Q2M3X8-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
24916, 61 antibodies

Genome annotation databases

EnsembliENSMUST00000066928; ENSMUSP00000066663; ENSMUSG00000054728 [Q2M3X8-2]
ENSMUST00000110161; ENSMUSP00000105790; ENSMUSG00000054728 [Q2M3X8-4]
ENSMUST00000128646; ENSMUSP00000122232; ENSMUSG00000054728 [Q2M3X8-1]
ENSMUST00000148891; ENSMUSP00000115228; ENSMUSG00000054728 [Q2M3X8-3]
ENSMUST00000149235; ENSMUSP00000115207; ENSMUSG00000054728 [Q2M3X8-1]
GeneIDi218194
KEGGimmu:218194
UCSCiuc007qfo.2, mouse [Q2M3X8-1]
uc007qfp.1, mouse [Q2M3X8-3]
uc007qfq.1, mouse [Q2M3X8-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
221692
MGIiMGI:2659021, Phactr1

Phylogenomic databases

GeneTreeiENSGT00940000155842
HOGENOMiCLU_015753_3_0_1
InParanoidiQ2M3X8
OMAiTQHHHTV
OrthoDBi1205245at2759
PhylomeDBiQ2M3X8
TreeFamiTF316316

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
218194, 0 hits in 53 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Phactr1, mouse

Protein Ontology

More...
PROi
PR:Q2M3X8
RNActiQ2M3X8, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000054728, Expressed in dorsal striatum and 261 other tissues
GenevisibleiQ2M3X8, MM

Family and domain databases

InterProiView protein in InterPro
IPR029987, Phactr1
IPR004018, RPEL_repeat
PANTHERiPTHR12751:SF6, PTHR12751:SF6, 2 hits
PfamiView protein in Pfam
PF02755, RPEL, 4 hits
SMARTiView protein in SMART
SM00707, RPEL, 4 hits
PROSITEiView protein in PROSITE
PS51073, RPEL, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPHAR1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q2M3X8
Secondary accession number(s): B1B1B5
, B1B1B6, B1B1B7, G5E8P7, Q80VL9, Q8C873
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: February 21, 2006
Last modified: April 7, 2021
This is version 111 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again