Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 127 (17 Jun 2020)
Sequence version 1 (21 Feb 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

NACHT, LRR and PYD domains-containing protein 1a

Gene

Nlrp1a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

As a potential sensor component of the NLRP1 inflammasome, plays a crucial role in innate immunity and inflammation. In response to pathogens and other damage-associated signals, initiates the formation of the inflammasome polymeric complex, made of Nlrp1b, CASP1, and possibly PYCARD. Recruitment of proCASP1 to the inflammasome promotes its activation and CASP1-catalyzed IL1B and IL18 maturation and secretion in the extracellular milieu. Activation of NLRP1 inflammasome is also required for HMGB1 secretion. The active cytokines and HMGB1 stimulate inflammatory responses. Inflammasomes can also induce pyroptosis, an inflammatory form of programmed cell death (By similarity) (PubMed:23219391). When activated in the bone marrow, induces the pyroptosis of hematopoietic stem cells and progenitor cells of both myeloid and lymphoid lineages, hence allowing the removal of damaged cells, and the release of IL1B, which induces granulopoiesis (PubMed:23219391). Binds ATP (By similarity).By similarity1 Publication

Miscellaneous

NLRP1 inflammasome activation of CASP1 and IL1B maturation can be dampened by direct contact with activated effector and memory T-cells. This effect may be mediated by hexameric TNF ligands, such as CD40LG and is predominantly observed in the skin.By similarity1 Publication
Three tandem Nrlp1 paralogs, Nrlp1a, Nrlp1b and Nrlp1c, are present in at least 2 strains, C57BL/6J and 129S1/SvImJ. Nlrp1c is predicted to be a pseudogene. Nlrp1b is the primary mediator of macrophage susceptibility to Bacillus anthracis lethal toxin (LT). Neither Nlrp1a, nor Nrlp1c are expressed in anthrax lethal toxin susceptible strains, hence neither of them is thought to play an important role in this phenotype.1 Publication1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi139 – 146ATPPROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-844455 The NLRP1 inflammasome

Protein family/group databases

MEROPS protease database

More...
MEROPSi
S79.A02

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NACHT, LRR and PYD domains-containing protein 1a
Alternative name(s):
Caspase recruitment domain-containing protein 7
Death effector filament-forming ced-4-like apoptosis protein
Nucleotide-binding domain and caspase recruitment domain
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Nlrp1a
Synonyms:Card7, Nalp1, Nalp1a, Nlrp1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2684861 Nlrp1a

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Inflammasome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi593Q → P: Constitutively active in IL1B release. In conventional housing conditions, mice bearing this mutation develop a systemic inflammatory phenotype associated with elevated IL1B and IL18 levels at 3-5 months of age. In a germ-free environment, they exhibit neutrophilia and myocarditis. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004351021 – 1182NACHT, LRR and PYD domains-containing protein 1aAdd BLAST1182

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei932 – 933Cleavage; by autolysisPROSITE-ProRule annotationBy similarity2

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q2LKU9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q2LKU9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q2LKU9

PRoteomics IDEntifications database

More...
PRIDEi
Q2LKU9

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q2LKU9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q2LKU9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in hematopoietic stem cells and progenitor cells of both myeloid and lymphoid origin (PubMed:23219391). The expression is highly strain-dependent. Not expressed in Balb/cJ animals, but widely expressed in C57BL/6J. Expressed in macrophages resistant to Bacillus anthracis lethal toxin, but not in toxin-sensitive macrophages, except in CAST/EiJ strain (PubMed:23506131).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000069830 Expressed in bone marrow macrophage and 12 other tissues

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Sensor component of NLRP1 inflammasomes. Inflammasomes are supramolecular complexes that assemble in the cytosol in response to pathogens and other damage-associated signals and play critical roles in innate immunity and inflammation. Classical inflammasomes consist of a signal sensor component, an adapter (ASC/PYCARD), which recruits an effector proinflammatory caspase (CASP1 and possibly CASP4/CASP11). CASP1 filament formation increases local enzyme concentration, resulting in trans-autocleavage and activation. Active CASP1 then processes IL1B and IL18 precursors, leading to the release of mature cytokines in the extracellular milieu and inflammatory response. In NLRP1 inflammasome, the role of PYCARD is not clear. Following activation, Nlrp1b may directly interact with CASP1 (through the CARD domain) to form a functional inflammasome. Hence PYCARD may not be necessary for NLRP1 and CASP1 interaction, but is required for speck formation and full inflammasome activity (By similarity) (PubMed:23219391). Homomer (By similarity).

Interacts (via LRR repeats) with BCL2 and BCL2L1 (via the loop between motifs BH4 and BH3); these interactions reduce NLRP1 inflammasome-induced CASP1 activation and IL1B release, possibly by impairing NLRP1 interaction with PYCARD (By similarity).

Interacts with NOD2; this interaction may lead to increased IL1B release (By similarity).

Interacts with EIF2AK2/PKR; this interaction requires EIF2AK2 activity, is accompanied by EIF2AK2 autophosphorylation and promotes inflammasome assembly in response to dange-associated signals (By similarity).

Interacts with MEFV; this interaction targets NLRP1 to degradation by autophagy, hence preventing excessive IL1B- and IL18-mediated inflammation (By similarity).

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-4271 NLRP1a inflammasome

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000104158

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q2LKU9 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q2LKU9

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini133 – 442NACHTPROSITE-ProRule annotationAdd BLAST310
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati634 – 655LRR 1Add BLAST22
Repeati691 – 711LRR 2Add BLAST21
Repeati720 – 743LRR 3Add BLAST24
Domaini799 – 1082FIINDPROSITE-ProRule annotationAdd BLAST284
Domaini1092 – 1175CARDPROSITE-ProRule annotationAdd BLAST84

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The CARD domain might be involved in the interaction with PYCARD, CASP1 and CASP4/CASP11.By similarity
The leucine-rich repeat (LRR) domain may be involved in autoinhibition in the absence of activating signal, possibly through intramolecular interaction with the NACHT domain.By similarity
The FIIND (domain with function to find) region is involved in homomerization, but not in CASP1-binding. Autocatalytic cleavage in this region occurs constitutively, prior to activation signals, and is required for inflammasome activity (IL1B release), possibly by facilitating CASP1 binding. Both N- and C-terminal fragments remain associated.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NLRP family.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410JAIN Eukaryota
ENOG410YGKV LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162176

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_002274_2_4_1

KEGG Orthology (KO)

More...
KOi
K12798

Identification of Orthologs from Complete Genome Data

More...
OMAi
YFTEESQ

Database of Orthologous Groups

More...
OrthoDBi
114368at2759

TreeFam database of animal gene trees

More...
TreeFami
TF340267

Family and domain databases

Conserved Domains Database

More...
CDDi
cd08330 CARD_ASC_NALP1, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.80.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001315 CARD
IPR033516 CARD8/ASC/NALP1_CARD
IPR011029 DEATH-like_dom_sf
IPR025307 FIIND_dom
IPR001611 Leu-rich_rpt
IPR032675 LRR_dom_sf
IPR007111 NACHT_NTPase
IPR041267 NLRC_HD2
IPR041075 NOD2_WH
IPR027417 P-loop_NTPase

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00619 CARD, 1 hit
PF13553 FIIND, 1 hit
PF13516 LRR_6, 1 hit
PF05729 NACHT, 1 hit
PF17776 NLRC4_HD2, 1 hit
PF17779 NOD2_WH, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47986 SSF47986, 1 hit
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50209 CARD, 1 hit
PS51830 FIIND, 1 hit
PS51450 LRR, 3 hits
PS50837 NACHT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q2LKU9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEESQSKQES STKVAQHEGQ EDVDPTFKTK KLMEVELMKH RVQLERNLKL
60 70 80 90 100
RTFPGARTKQ VKEALYPLLT WSSKSKNLFQ NFTKLLLFKK LCQRGSENLV
110 120 130 140 150
RESWYPCVPE EEAHMIDIQD LFGPNLGTQK KPQLVIIEGA AGIGKSTLAR
160 170 180 190 200
LVKRAWKEGK LYRNDFHHVF FFSCRELAQY EQLSLAELIV QGQEVPTAPI
210 220 230 240 250
RQILSHPEKL LFILDGIDEP AWVLADQNPE LCLHWSQTQP VHTLLGSLLG
260 270 280 290 300
KSILPGASFL LTTRTTALQK FIPSLEQPCQ VEVLGFTLFE RKNYFYKYFG
310 320 330 340 350
KKKGGVTTFT LVKSNSALLT LCEVPWVCWL VCTCLKKQME QGGELSLTSQ
360 370 380 390 400
TTTALCLKYL SLTIPGQHMR TQLRDLCSLA AEGVCQRRTL FSESDLCKQG
410 420 430 440 450
LDEHAIASFL KIGVLQKQAS SLSYSFAHLC LQEFFAAMSY ILDDSEERHA
460 470 480 490 500
DMKNDRIVET LVERYGRQNL FEAPTVRFLF GLLSKEELKK IEKLFSCSLH
510 520 530 540 550
GKTKLKLLWH ILGKSQPHQP PCLGLLHCLY ENQDMELLTH VMHDLQGTIV
560 570 580 590 600
PGPDDLAHTV LQTNVKHLVI QTDMDLMVVT FCIKFCCHVR SLQLNRKVQQ
610 620 630 640 650
GHKFTAPGMV LYRWTPITDA SWKIFFSNLK LARNLEELDL SGNPLSYYAV
660 670 680 690 700
HSLCTTLRKR GCQLKTLWLV ECGLTSTYCS LLASVLSARS SLTELDLQLN
710 720 730 740 750
DLGDGGVKML CEGLRNPACN LSILWLDQAS LSDQVIAELR TLEAKNPKLL
760 770 780 790 800
ISSTWKPHVM VPTMNMDKEE VGDSQALLKQ QRQQSGDKHM EPLGTEDEFW
810 820 830 840 850
GPTGPVTTEV VDRERNLYRV QLPMAGSYHC PSTGLHFVVT RAVTIEIEFC
860 870 880 890 900
AWSQYLDKTP LQQSHMVVGP LFDIKAEQGA VTAVYLPHFV ALQEGIVDSS
910 920 930 940 950
LFHVAHFQEH GMVLETPARV EQHYAVLENP SFSPMGILLR MIPAVGHFIP
960 970 980 990 1000
ITSTTLIYYH LYLEDVTFHL YLVPNDCSIR KAIDDEEMKF QFVRINKPPP
1010 1020 1030 1040 1050
VDALYLGSRY IVSSSKLVEI IPKELELCYR SPGESQLFSE IDIGHMDSEI
1060 1070 1080 1090 1100
KLQIKDKRHM NLKWEALLKP GDLRPALPKI ATAPKDAPSL LHFMDQHREQ
1110 1120 1130 1140 1150
LVARVTSVDP LLDKLHGLVL SEDSYEVVRS ETTNQDKMRK LFSLSRSWSW
1160 1170 1180
DCKDQFYQAL KETHPHLVMD ILEKLGGVSV KS
Length:1,182
Mass (Da):134,308
Last modified:February 21, 2006 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD6D3F9FD5629D44A
GO
Isoform 2 (identifier: Q2LKU9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     668-668: W → CTLPEDMNKAEVKNTEAKGSLGEKAPGPRNDIFPFPPAHCPYNQTSTSEHLPCR
     785-785: S → SGMVGWLLKEDNVKKIKQNATNTYAHTHTHTHAELVPLKTFHPCSPVSP
     1072-1085: DLRPALPKIATAPK → KISLRPETLRVEERDTKGAFLCSFPVSSLSL

Show »
Length:1,300
Mass (Da):147,378
Checksum:i6AAAF5A8CB4CD0B5
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti228N → D in BAE33940 (PubMed:16141072).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural varianti3E → K in strain: CAST/EiJ. 1 Publication1
Natural varianti88F → Y in strain: PWK/PhJ. 1 Publication1
Natural varianti112E → G in strain: CAST/EiJ, DBA/2J and PWK/PhJ. 1 Publication1
Natural varianti227Q → R in strain: PWK/PhJ. 1 Publication1
Natural varianti256G → E in strain: CAST/EiJ, DBA/2J and PWK/PhJ. 1 Publication1
Natural varianti291R → Q in strain: DBA/2J. 1 Publication1
Natural varianti337K → N in strain: PWK/PhJ. 1 Publication1
Natural varianti484S → G in strain: DBA/2J and CAST/EiJ. 1 Publication1
Natural varianti541V → M in strain: PWK/PhJ. 1 Publication1
Natural varianti660R → H in strain: AKR/J. 1 Publication1
Natural varianti664L → I in strain: PWK/PhJ. 1 Publication1
Natural varianti705G → D in strain: DBA/2J. 1 Publication1
Natural varianti857D → N in strain: PWK/PhJ. 1 Publication1
Natural varianti975N → S in strain: PWK/PhJ. 1 Publication1
Natural varianti1030R → Q in strain: DBA/2J. 1 Publication1
Natural varianti1043I → F in strain: CAST/EiJ. 1 Publication1
Natural varianti1110P → S in strain: DBA/2J. 1 Publication1
Natural varianti1181K → R in strain: CAST/EiJ and DBA/2J. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_058002668W → CTLPEDMNKAEVKNTEAKGS LGEKAPGPRNDIFPFPPAHC PYNQTSTSEHLPCR in isoform 2. 1
Alternative sequenceiVSP_058003785S → SGMVGWLLKEDNVKKIKQNA TNTYAHTHTHTHAELVPLKT FHPCSPVSP in isoform 2. 1
Alternative sequenceiVSP_0580041072 – 1085DLRPA…ATAPK → KISLRPETLRVEERDTKGAF LCSFPVSSLSL in isoform 2. Add BLAST14

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ117601 mRNA Translation: AAZ40527.1
KC539856 mRNA Translation: AGH68332.1
KC539857 mRNA Translation: AGH68333.1
KC539858 mRNA Translation: AGH68334.1
KC539859 mRNA Translation: AGH68335.1
KC539860 mRNA Translation: AGH68336.1
KC539861 mRNA Translation: AGH68337.1
AY355339 mRNA Translation: AAR14736.1
AL596136 Genomic DNA No translation available.
AL662908 Genomic DNA No translation available.
AK157034 mRNA Translation: BAE33940.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS48838.1 [Q2LKU9-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001004142.2, NM_001004142.2 [Q2LKU9-1]
XP_017169843.1, XM_017314354.1 [Q2LKU9-1]
XP_017169844.1, XM_017314355.1 [Q2LKU9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000048514; ENSMUSP00000038186; ENSMUSG00000069830 [Q2LKU9-2]
ENSMUST00000108518; ENSMUSP00000104158; ENSMUSG00000069830 [Q2LKU9-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
195046

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:195046

UCSC genome browser

More...
UCSCi
uc007jxq.2 mouse [Q2LKU9-1]
uc011xyf.1 mouse

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ117601 mRNA Translation: AAZ40527.1
KC539856 mRNA Translation: AGH68332.1
KC539857 mRNA Translation: AGH68333.1
KC539858 mRNA Translation: AGH68334.1
KC539859 mRNA Translation: AGH68335.1
KC539860 mRNA Translation: AGH68336.1
KC539861 mRNA Translation: AGH68337.1
AY355339 mRNA Translation: AAR14736.1
AL596136 Genomic DNA No translation available.
AL662908 Genomic DNA No translation available.
AK157034 mRNA Translation: BAE33940.1
CCDSiCCDS48838.1 [Q2LKU9-1]
RefSeqiNP_001004142.2, NM_001004142.2 [Q2LKU9-1]
XP_017169843.1, XM_017314354.1 [Q2LKU9-1]
XP_017169844.1, XM_017314355.1 [Q2LKU9-1]

3D structure databases

SMRiQ2LKU9
ModBaseiSearch...

Protein-protein interaction databases

ComplexPortaliCPX-4271 NLRP1a inflammasome
STRINGi10090.ENSMUSP00000104158

Protein family/group databases

MEROPSiS79.A02

PTM databases

iPTMnetiQ2LKU9
PhosphoSitePlusiQ2LKU9

Proteomic databases

EPDiQ2LKU9
MaxQBiQ2LKU9
PaxDbiQ2LKU9
PRIDEiQ2LKU9

Genome annotation databases

EnsembliENSMUST00000048514; ENSMUSP00000038186; ENSMUSG00000069830 [Q2LKU9-2]
ENSMUST00000108518; ENSMUSP00000104158; ENSMUSG00000069830 [Q2LKU9-1]
GeneIDi195046
KEGGimmu:195046
UCSCiuc007jxq.2 mouse [Q2LKU9-1]
uc011xyf.1 mouse

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
195046
MGIiMGI:2684861 Nlrp1a

Phylogenomic databases

eggNOGiENOG410JAIN Eukaryota
ENOG410YGKV LUCA
GeneTreeiENSGT00940000162176
HOGENOMiCLU_002274_2_4_1
KOiK12798
OMAiYFTEESQ
OrthoDBi114368at2759
TreeFamiTF340267

Enzyme and pathway databases

ReactomeiR-MMU-844455 The NLRP1 inflammasome

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
195046 0 hits in 12 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Nlrp1a mouse

Protein Ontology

More...
PROi
PR:Q2LKU9
RNActiQ2LKU9 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000069830 Expressed in bone marrow macrophage and 12 other tissues

Family and domain databases

CDDicd08330 CARD_ASC_NALP1, 1 hit
Gene3Di3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR001315 CARD
IPR033516 CARD8/ASC/NALP1_CARD
IPR011029 DEATH-like_dom_sf
IPR025307 FIIND_dom
IPR001611 Leu-rich_rpt
IPR032675 LRR_dom_sf
IPR007111 NACHT_NTPase
IPR041267 NLRC_HD2
IPR041075 NOD2_WH
IPR027417 P-loop_NTPase
PfamiView protein in Pfam
PF00619 CARD, 1 hit
PF13553 FIIND, 1 hit
PF13516 LRR_6, 1 hit
PF05729 NACHT, 1 hit
PF17776 NLRC4_HD2, 1 hit
PF17779 NOD2_WH, 1 hit
SUPFAMiSSF47986 SSF47986, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50209 CARD, 1 hit
PS51830 FIIND, 1 hit
PS51450 LRR, 3 hits
PS50837 NACHT, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNLR1A_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q2LKU9
Secondary accession number(s): M4T3K8
, M4T4C8, M4T632, M4TJP5, Q3U0B5, Q67EY4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 9, 2015
Last sequence update: February 21, 2006
Last modified: June 17, 2020
This is version 127 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again