Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 106 (08 May 2019)
Sequence version 1 (21 Feb 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Histone-lysine N-methyltransferase ASHH2

Gene

ASHH2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Histone methyltransferase involved in di and tri-methylation of 'Lys-36' of histone H3 (H3K36me2 and H3K36me3). Binds to H3 already mono- or di-methylated on 'Lys-4'(H3K4me1 or H3K4me2), but not to H3K4me3. H3K4me and H3K36me represent specific tags for epigenetic transcriptional activation. Regulates positively FLC transcription to prevent early flowering transition. Required for flowering transition in response to vernalization and for the maintenance of FLC expression in late embryos, but dispensable for the initial reactivation in early embryos during reprogramming. Seems also to modulate several traits including floral organ size, root size and dormancy. Promotes apical dominance (PubMed:16299497, PubMed:10518493, PubMed:16258034, PubMed:18070919, PubMed:19915673, PubMed:20711170). Directly involved in the tri-methylation of 'Lys-36' of histone H3 (H3K36me3) at LAZ5 chromatin to maintain a transcriptionally active state of LAZ5, a TIR-NB-LRR protein involved in innate immunity (PubMed:20949080). Required for brassinosteroid (BR)-induced gene expression and histone H3 trimethylation on 'Lys-36' (H3K36me3) in BR-regulated genes (PubMed:24838002).8 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi868Zinc1 Publication1
Metal bindingi871Zinc1 Publication1
Metal bindingi893Zinc1 Publication1
Metal bindingi904Zinc1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei1142S-adenosyl-L-methioninePROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri859 – 912CW-typePROSITE-ProRule annotationAdd BLAST54

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChromatin regulator, Methyltransferase, Transferase
LigandMetal-binding, S-adenosyl-L-methionine, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Histone-lysine N-methyltransferase ASHH2 (EC:2.1.1.43)
Alternative name(s):
ASH1 homolog 21 Publication
H3-K4-HMTase
Histone H3-K36 methyltransferase 8
Short name:
H3-K36-HMTase 8
Protein EARLY FLOWERING IN SHORT DAYS
Protein LAZARUS 21 Publication
Protein SET DOMAIN GROUP 8
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ASHH21 Publication
Synonyms:EFS, LAZ21 Publication, SDG8, SET8
Ordered Locus Names:At1g77300
ORF Names:T14N5.15
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT1G77300

The Arabidopsis Information Resource

More...
TAIRi
locus:2196000 AT1G77300

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Early flowering. Pleiotropic developmental effects including dwarf and bushy phenotype, reduced seed setting and defects in ovule and embryo sac development (PubMed:18070919, PubMed:19915673, PubMed:24838002). Altered responses to brassinosteroid (BR) (PubMed:24838002).3 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi865W → A: Loss of histone tail binding. 1 Publication1
Mutagenesisi874W → A: Loss of histone tail binding. 1 Publication1
Mutagenesisi891W → A: Loss of histone tail binding. 1 Publication1
Mutagenesisi908Q → A: Loss of histone tail binding. 1 Publication1
Mutagenesisi909E → A: Loss of histone tail binding. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002333711 – 1759Histone-lysine N-methyltransferase ASHH2Add BLAST1759

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q2LAE1

PRoteomics IDEntifications database

More...
PRIDEi
Q2LAE1

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q2LAE1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous, with higher levels in young tissues, including shoot and root apex. Expressed in ovules, tapetum layer and microspores.4 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Not regulated by vernalization.1 Publication

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q2LAE1 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with FRI and SUF4, two components of the transcription activator complex FRI-C, and with SWC6, a component of the SWR1 chromatin-remodeling complex (PubMed:20711170, PubMed:21282526, PubMed:21522130).

Interacts with BZR2/BES1 and IWS1 (PubMed:24838002).

4 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
29285, 15 interactors

Protein interaction database and analysis system

More...
IntActi
Q2LAE1, 2 interactors

Molecular INTeraction database

More...
MINTi
Q2LAE1

STRING: functional protein association networks

More...
STRINGi
3702.AT1G77300.1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11759
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q2LAE1

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini974 – 1024AWSPROSITE-ProRule annotationAdd BLAST51
Domaini1026 – 1143SETPROSITE-ProRule annotationAdd BLAST118
Domaini1151 – 1167Post-SETPROSITE-ProRule annotationAdd BLAST17

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1400 – 1405Poly-Leu6

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri859 – 912CW-typePROSITE-ProRule annotationAdd BLAST54

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4442 Eukaryota
COG2940 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000029212

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q2LAE1

Identification of Orthologs from Complete Genome Data

More...
OMAi
HQFGSPG

Database of Orthologous Groups

More...
OrthoDBi
45878at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q2LAE1

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006560 AWS_dom
IPR003616 Post-SET_dom
IPR001214 SET_dom
IPR011124 Znf_CW

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF17907 AWS, 1 hit
PF00856 SET, 1 hit
PF07496 zf-CW, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00570 AWS, 1 hit
SM00508 PostSET, 1 hit
SM00317 SET, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51215 AWS, 1 hit
PS50868 POST_SET, 1 hit
PS50280 SET, 1 hit
PS51050 ZF_CW, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q2LAE1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDCKENGVGD ASGCNIDANS LASNLAMNTN EDFYEKLSSR GQNLDSVSSL
60 70 80 90 100
EIPQTASSVN HTIEGQRKCF TEIEQMGYGN SNSQEDAGNT DDDLYVCYNA
110 120 130 140 150
DDTQEQGVVS GELEQSQELI CDTDLLVNCN KLDDGKESQD TNVSLVSIFS
160 170 180 190 200
GSMQEKEAPQ AKEDEGYGGT TLPIGGSGID TESTFVNDAP EQFESLETTK
210 220 230 240 250
HIKPDEVESD GISYRFDDGG KEGRNGPSSD LDTGSSDDIS LSQSFSFPDS
260 270 280 290 300
LLDSSVFGCS ATESYLEDAI DIEGNGTIVV SPSLAITEML NNDDGGLCSH
310 320 330 340 350
DLNKITVTET INPDLKLVRE DRLDTDLSVM NEKMLKNHVG DSSSESAVAA
360 370 380 390 400
LSMNNGMAAD LRAENFSQSS PIDEKTLDME ANSPITDSSL IWNFPLNFGS
410 420 430 440 450
GGIEVCNPEN AVEPLRIVDD NGRIGGEVAS ASGSDFCEAG MSSSRRKARD
460 470 480 490 500
GKQCKVVQTK TSARHLRKSS RKKQSERDIE SIFKCSKQKR SSLLKTSRSS
510 520 530 540 550
EWGLPSKTTE IFLQSNNIPY DGPPHHEPQR SQGNLNNGEH NRSSHNGNVE
560 570 580 590 600
GSNRNIQASS GSCLRLKVKF GKSGGQNPLN ITVSKVSGNS LPGNGIVKAG
610 620 630 640 650
TCLELPGSAH FGEDKMQTVE TKEDLVEKSN PVEKVSYLQS SDSMRDKKYN
660 670 680 690 700
QDAGGLCRKV GGDVLDDDPH LSSIRMVEEC ERATGTQSLD AETSPDSEVI
710 720 730 740 750
NSVPDSIVNI EHKEGLHHGF FSTPEDVVKK NRVLEKEDEL RASKSPSENG
760 770 780 790 800
SHLIPNAKKA KHPKSKSNGT KKGKSKFSES AKDGRKNESH EGVEQRKSLN
810 820 830 840 850
TSMGRDDSDY PEVGRIESHK TTGALLDADI GKTSATYGTI SSDVTHGEMV
860 870 880 890 900
VDVTIEDSYS TESAWVRCDD CFKWRRIPAS VVGSIDESSR WICMNNSDKR
910 920 930 940 950
FADCSKSQEM SNEEINEELG IGQDEADAYD CDAAKRGKEK EQKSKRLTGK
960 970 980 990 1000
QKACFKAIKT NQFLHRNRKS QTIDEIMVCH CKPSPDGRLG CGEECLNRML
1010 1020 1030 1040 1050
NIECLQGTCP AGDLCSNQQF QKRKYVKFER FQSGKKGYGL RLLEDVREGQ
1060 1070 1080 1090 1100
FLIEYVGEVL DMQSYETRQK EYAFKGQKHF YFMTLNGNEV IDAGAKGNLG
1110 1120 1130 1140 1150
RFINHSCEPN CRTEKWMVNG EICVGIFSMQ DLKKGQELTF DYNYVRVFGA
1160 1170 1180 1190 1200
AAKKCYCGSS HCRGYIGGDP LNGDVIIQSD SDEEYPELVI LDDDESGEGI
1210 1220 1230 1240 1250
LGATSRTFTD DADEQMPQSF EKVNGYKDLA PDNTQTQSSV SVKLPEREIP
1260 1270 1280 1290 1300
PPLLQPTEVL KELSSGISIT AVQQEVPAEK KTKSTSPTSS SLSRMSPGGT
1310 1320 1330 1340 1350
NSDKTTKHGS GEDKKILPRP RPRMKTSRSS ESSKRDKGGI YPGVNKAQVI
1360 1370 1380 1390 1400
PVNKLQQQPI KSKGSEKVSP SIETFEGKLN ELLDAVGGIS KRRDSAKGYL
1410 1420 1430 1440 1450
KLLLLTAASR GTDEEGIYSN RDLSMILDAL LKTKSKSVLV DIINKNGPFA
1460 1470 1480 1490 1500
GMESFKDSVL SFTEHDDYTV HNIARSFRDR WIPKHFRKPW RINREERSES
1510 1520 1530 1540 1550
MRSPINRRFR ASQEPRYDHQ SPRPAEPAAS VTSSKAATPE TASVSEGYSE
1560 1570 1580 1590 1600
PNSGLPETNG RKRKSRWDQP SKTKEQRIMT ILSQQTDETN GNQDVQDDLP
1610 1620 1630 1640 1650
PGFSSPCTDV PDAITAQPQQ KFLSRLPVSY GIPLSIVHQF GSPGKEDPTT
1660 1670 1680 1690 1700
WSVAPGMPFY PFPPLPPVSH GEFFAKRNVR ACSSSMGNLT YSNEILPATP
1710 1720 1730 1740 1750
VTDSTAPTRK RELFSSDIGT TYFRQQKQSV PPWLRNNGGE KTANSPIPGN

LTLEKKLNS
Length:1,759
Mass (Da):193,228
Last modified:February 21, 2006 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5616BE25ECEF2155
GO
Isoform 2 (identifier: Q2LAE1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1447-1447: G → GLQMLHNIMKQYRGDFKRIPIIRKLLKVLEYLATRKILALEHIIRRP

Note: No experimental confirmation available.
Show »
Length:1,805
Mass (Da):198,851
Checksum:i79D63F4C931B15D0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F4I6Z9F4I6Z9_ARATH
Histone-lysine N-methyltransferase
EFS ASH1 HOMOLOG 2, ASHH2, CCR1, EARLY FLOWERING IN SHORT DAYS, LAZ2
1,501Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC34358 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence BAD94318 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1426I → T in BAD94318 (Ref. 4) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0181331447G → GLQMLHNIMKQYRGDFKRIP IIRKLLKVLEYLATRKILAL EHIIRRP in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ340869 mRNA Translation: ABC69038.1
EU014690 mRNA Translation: ABV68921.1
AC004260 Genomic DNA Translation: AAC34358.1 Sequence problems.
CP002684 Genomic DNA Translation: AEE35960.1
AK221916 mRNA Translation: BAD94318.1 Different initiation.

Protein sequence database of the Protein Information Resource

More...
PIRi
T00458

NCBI Reference Sequences

More...
RefSeqi
NP_177854.6, NM_106379.9 [Q2LAE1-2]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT1G77300.1; AT1G77300.1; AT1G77300 [Q2LAE1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
844066

Gramene; a comparative resource for plants

More...
Gramenei
AT1G77300.1; AT1G77300.1; AT1G77300 [Q2LAE1-2]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT1G77300

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ340869 mRNA Translation: ABC69038.1
EU014690 mRNA Translation: ABV68921.1
AC004260 Genomic DNA Translation: AAC34358.1 Sequence problems.
CP002684 Genomic DNA Translation: AEE35960.1
AK221916 mRNA Translation: BAD94318.1 Different initiation.
PIRiT00458
RefSeqiNP_177854.6, NM_106379.9 [Q2LAE1-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2L7PNMR-A849-937[»]
5YVXX-ray1.59A862-921[»]
6HBONMR-A861-928[»]
SMRiQ2LAE1
ModBaseiSearch...

Protein-protein interaction databases

BioGridi29285, 15 interactors
IntActiQ2LAE1, 2 interactors
MINTiQ2LAE1
STRINGi3702.AT1G77300.1

PTM databases

iPTMnetiQ2LAE1

Proteomic databases

PaxDbiQ2LAE1
PRIDEiQ2LAE1

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT1G77300.1; AT1G77300.1; AT1G77300 [Q2LAE1-2]
GeneIDi844066
GrameneiAT1G77300.1; AT1G77300.1; AT1G77300 [Q2LAE1-2]
KEGGiath:AT1G77300

Organism-specific databases

AraportiAT1G77300
TAIRilocus:2196000 AT1G77300

Phylogenomic databases

eggNOGiKOG4442 Eukaryota
COG2940 LUCA
HOGENOMiHOG000029212
InParanoidiQ2LAE1
OMAiHQFGSPG
OrthoDBi45878at2759
PhylomeDBiQ2LAE1

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q2LAE1

Gene expression databases

ExpressionAtlasiQ2LAE1 baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR006560 AWS_dom
IPR003616 Post-SET_dom
IPR001214 SET_dom
IPR011124 Znf_CW
PfamiView protein in Pfam
PF17907 AWS, 1 hit
PF00856 SET, 1 hit
PF07496 zf-CW, 1 hit
SMARTiView protein in SMART
SM00570 AWS, 1 hit
SM00508 PostSET, 1 hit
SM00317 SET, 1 hit
PROSITEiView protein in PROSITE
PS51215 AWS, 1 hit
PS50868 POST_SET, 1 hit
PS50280 SET, 1 hit
PS51050 ZF_CW, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiASHH2_ARATH
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q2LAE1
Secondary accession number(s): A9QA57, O80663, Q56WW4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: February 21, 2006
Last modified: May 8, 2019
This is version 106 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again