Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glutamine and serine-rich protein 1

Gene

QSER1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Glutamine and serine-rich protein 1
Gene namesi
Name:QSER1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000060749.14
HGNCiHGNC:26154 QSER1
neXtProtiNX_Q2KHR3

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000060749
PharmGKBiPA143485589

Polymorphism and mutation databases

BioMutaiQSER1
DMDMi308153569

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002889331 – 1735Glutamine and serine-rich protein 1Add BLAST1735

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei586PhosphoserineCombined sources1
Modified residuei615PhosphoserineCombined sources1
Modified residuei886PhosphoserineCombined sources1
Modified residuei949PhosphothreonineCombined sources1
Modified residuei987PhosphoserineCombined sources1
Cross-linki1058Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1083Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei1211PhosphoserineCombined sources1
Modified residuei1230PhosphoserineCombined sources1
Modified residuei1231PhosphoserineCombined sources1
Modified residuei1239PhosphoserineCombined sources1
Modified residuei1341PhosphothreonineCombined sources1
Modified residuei1348PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ2KHR3
MaxQBiQ2KHR3
PaxDbiQ2KHR3
PeptideAtlasiQ2KHR3
PRIDEiQ2KHR3
ProteomicsDBi61307
61308 [Q2KHR3-2]

PTM databases

iPTMnetiQ2KHR3
PhosphoSitePlusiQ2KHR3

Expressioni

Gene expression databases

BgeeiENSG00000060749 Expressed in 213 organ(s), highest expression level in caput epididymis
CleanExiHS_QSER1
ExpressionAtlasiQ2KHR3 baseline and differential
GenevisibleiQ2KHR3 HS

Organism-specific databases

HPAiHPA005682

Interactioni

Protein-protein interaction databases

BioGridi122924, 27 interactors
IntActiQ2KHR3, 16 interactors
MINTiQ2KHR3
STRINGi9606.ENSP00000382241

Structurei

3D structure databases

ProteinModelPortaliQ2KHR3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi120 – 527Ser-richAdd BLAST408
Compositional biasi641 – 789Gln-richAdd BLAST149

Phylogenomic databases

eggNOGiKOG4805 Eukaryota
ENOG410XTD1 LUCA
GeneTreeiENSGT00440000037417
HOGENOMiHOG000232191
HOVERGENiHBG089439
InParanoidiQ2KHR3
OMAiGEGMYRE
OrthoDBiEOG091G00EN
PhylomeDBiQ2KHR3
TreeFamiTF333141

Family and domain databases

InterProiView protein in InterPro
IPR025451 DUF4211
PfamiView protein in Pfam
PF13926 DUF4211, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q2KHR3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNFLSTAESR TAQAAASGTT LLPQFRAPSW QTGMHSSAAT ELFATGPLPS
60 70 80 90 100
TGTLPPSLSA YQHPTTFSNR NFATTSPLVL QDSTFNTTSN GILSHHDPLL
110 120 130 140 150
QIKTSQGTVP TALAFERLGS SVLSNSIPPQ SSTYRSAQES APHLLQPQFS
160 170 180 190 200
LLPSALGGSQ QTPQAYSSTL FTSSTASIER ALLRECSVIK HHQRPSGTQS
210 220 230 240 250
IQAQLTGSQH SLHSYLSNSS VVNFQETTRQ SSLSCSPIGD STQVSNGGLQ
260 270 280 290 300
QKTSQVSVEL AQSYSSAIPS SGYPPSTTKI KSCSTEQPLT STKTPKPQSI
310 320 330 340 350
IPPVQTLSYS KPLHNQSSVI SGQAQIYSTA QLPSLLSVSQ SQNYGLVQPH
360 370 380 390 400
NVPSIVHSQV YRSSKVEKLP PLYKTLTFSG SSQTVTPENQ TLNYSSNQQE
410 420 430 440 450
VLSSVTNENY PAQTRDLSSV SQSQSYSSGH SQGLSPVSQT QVSYSSQSQV
460 470 480 490 500
LSVVSLSESY ASGESLTLTA PSLSYSSASR AQNLPDSSPT QNYISMHSSQ
510 520 530 540 550
NVQTQESSSP QSQKFLPAVQ SSSFASSTHC QTLQNNITSP DPKSYAERKL
560 570 580 590 600
DSDVYPSSKQ EDGFPMQELQ VLQPQASLES STQRLSDGEI NAQESTYKVS
610 620 630 640 650
KADDRYSQSV IRSNSRLEDQ VIGVALQASK KEESVVGSVT QLNQQIGQVN
660 670 680 690 700
NAATLDLKNS TNLIQTPQIR LNTKDLKQQH PLILKVHESK VQEQHDQIIN
710 720 730 740 750
ASSQIQIPNH ALGHGHQASL PNTQVLLDSA CDLQILQQSI LQAGLGQVKA
760 770 780 790 800
SLQAQRVQSP QQIVHPFLQM EGHVIQSNGD HSQQQLHPQN SEVMKMDLSE
810 820 830 840 850
SSKPLQQHLT TKGHFSETNQ HDSKNQFVSL GSMCFPEAVL LSDERNILSN
860 870 880 890 900
VDDILAATAA ACGVTPTDFS KSTSNETMQA VEDGDSKSHF QQSLDVRHVT
910 920 930 940 950
SDFNSMTATV GKPQNINDTS LNGNQVTVNL SPVPALQSKM TLDQQHIETP
960 970 980 990 1000
GQNIPTKVTS AVVGPSHEVQ EQSSGPFKKQ SATNLESEED SEAPVDSTLN
1010 1020 1030 1040 1050
NNRNQEFVSS SRSISGENAT SESEFTLGGD DSGVSMNPAR SALALLAMAQ
1060 1070 1080 1090 1100
SGDAVSVKIE EENQDLMHFN LQKKRAKGKG QVKEEDNSNQ KQLKRPAQGK
1110 1120 1130 1140 1150
RQNPRGTDIY LPYTPPSSES CHDGYQHQEK MRQKIKEVEE KQPEVKTGFI
1160 1170 1180 1190 1200
ASFLDFLKSG PKQQFSTLAV RMPNRTRRPG TQMVRTFCPP PLPKPSSTTP
1210 1220 1230 1240 1250
TPLVSETGGN SPSDKVDNEL KNLEHLSSFS SDEDDPGYSQ DAYKSVSTPL
1260 1270 1280 1290 1300
TTLDATSDKK KKTEALQVAT TSPTANTTGT ATTSSTTVGA VKQEPLHSTS
1310 1320 1330 1340 1350
YAVNILENIS SSESSKPIEL DGLPSDQFAK GQDTVAIEGF TDEEDTESGG
1360 1370 1380 1390 1400
EGQYRERDEF VVKIEDIETF KEALKTGKEP PAIWKVQKAL LQKFVPEIRD
1410 1420 1430 1440 1450
GQREFAATNS YLGYFGDAKS KYKRIYVKFI ENANKKEYVR VCSKKPRNKP
1460 1470 1480 1490 1500
SQTIRTVQAK PSSSSKTSDP LASKTTTTKA PSVKPKVKQP KVKAEPPPKK
1510 1520 1530 1540 1550
RKKWKEEFSS SQSDSSPEIH TSSSDDEEFE PPAPFVTRFL NTRAMKETFK
1560 1570 1580 1590 1600
SYMELLVSIA LDPDTMQALE KSNDELLLPH MKKIDGMLND NRKRLLLNLH
1610 1620 1630 1640 1650
LDQSFKNALE SFPELTIITR DSKAKSGGTA ISKIKMNGKA YNKKTLRTSK
1660 1670 1680 1690 1700
TTTKSAQEFA VDPEKIQLYS LYHSLHHYKY HVYLICKDEI SSVQKKNEDL
1710 1720 1730
GQEEIVQLCM KNVKWVEDLF EKFGELLNHV QQKCS
Length:1,735
Mass (Da):189,972
Last modified:October 5, 2010 - v3
Checksum:i9FC28818DBB42A92
GO
Isoform 2 (identifier: Q2KHR3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     243-481: Missing.
     1730-1735: VQQKCS → TGMLGEMQSVSVSSTRRSEQQNILEAGKSKIKVPVSGDC

Note: No experimental confirmation available.
Show »
Length:1,529
Mass (Da):168,003
Checksum:i811508C5F1B2FC4F
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YCQ7H0YCQ7_HUMAN
Glutamine and serine-rich protein 1
QSER1
780Annotation score:
E9PQD3E9PQD3_HUMAN
Glutamine and serine-rich protein 1
QSER1
64Annotation score:

Sequence cautioni

The sequence AAI12936 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAC86397 differs from that shown. Reason: Erroneous termination at position 1555. Translated as Leu.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti291S → P in AK125391 (PubMed:14702039).Curated1
Sequence conflicti486D → N in AK125391 (PubMed:14702039).Curated1
Sequence conflicti1075R → G in AK125391 (PubMed:14702039).Curated1
Sequence conflicti1247S → P in AK125391 (PubMed:14702039).Curated1
Sequence conflicti1258D → E in AK125391 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_056975385V → I2 PublicationsCorresponds to variant dbSNP:rs1022586Ensembl.1
Natural variantiVAR_032535644Q → R. Corresponds to variant dbSNP:rs2297781Ensembl.1
Natural variantiVAR_0325361018N → SCombined sources2 PublicationsCorresponds to variant dbSNP:rs7940077Ensembl.1
Natural variantiVAR_0325371304N → D. Corresponds to variant dbSNP:rs16923676Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_039815243 – 481Missing in isoform 2. 1 PublicationAdd BLAST239
Alternative sequenceiVSP_0398161730 – 1735VQQKCS → TGMLGEMQSVSVSSTRRSEQ QNILEAGKSKIKVPVSGDC in isoform 2. 1 Publication6

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK125391 mRNA No translation available.
AK126023 mRNA Translation: BAC86397.1 Sequence problems.
AC107939 Genomic DNA No translation available.
BC112935 mRNA Translation: AAI12936.1 Sequence problems.
CCDSiCCDS41631.1 [Q2KHR3-1]
RefSeqiNP_001070254.1, NM_001076786.2 [Q2KHR3-1]
UniGeneiHs.369368

Genome annotation databases

EnsembliENST00000399302; ENSP00000382241; ENSG00000060749 [Q2KHR3-1]
ENST00000527788; ENSP00000432766; ENSG00000060749 [Q2KHR3-2]
GeneIDi79832
KEGGihsa:79832
UCSCiuc001mty.4 human [Q2KHR3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK125391 mRNA No translation available.
AK126023 mRNA Translation: BAC86397.1 Sequence problems.
AC107939 Genomic DNA No translation available.
BC112935 mRNA Translation: AAI12936.1 Sequence problems.
CCDSiCCDS41631.1 [Q2KHR3-1]
RefSeqiNP_001070254.1, NM_001076786.2 [Q2KHR3-1]
UniGeneiHs.369368

3D structure databases

ProteinModelPortaliQ2KHR3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122924, 27 interactors
IntActiQ2KHR3, 16 interactors
MINTiQ2KHR3
STRINGi9606.ENSP00000382241

PTM databases

iPTMnetiQ2KHR3
PhosphoSitePlusiQ2KHR3

Polymorphism and mutation databases

BioMutaiQSER1
DMDMi308153569

Proteomic databases

EPDiQ2KHR3
MaxQBiQ2KHR3
PaxDbiQ2KHR3
PeptideAtlasiQ2KHR3
PRIDEiQ2KHR3
ProteomicsDBi61307
61308 [Q2KHR3-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000399302; ENSP00000382241; ENSG00000060749 [Q2KHR3-1]
ENST00000527788; ENSP00000432766; ENSG00000060749 [Q2KHR3-2]
GeneIDi79832
KEGGihsa:79832
UCSCiuc001mty.4 human [Q2KHR3-1]

Organism-specific databases

CTDi79832
EuPathDBiHostDB:ENSG00000060749.14
GeneCardsiQSER1
H-InvDBiHIX0009534
HIX0171325
HGNCiHGNC:26154 QSER1
HPAiHPA005682
neXtProtiNX_Q2KHR3
OpenTargetsiENSG00000060749
PharmGKBiPA143485589
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4805 Eukaryota
ENOG410XTD1 LUCA
GeneTreeiENSGT00440000037417
HOGENOMiHOG000232191
HOVERGENiHBG089439
InParanoidiQ2KHR3
OMAiGEGMYRE
OrthoDBiEOG091G00EN
PhylomeDBiQ2KHR3
TreeFamiTF333141

Miscellaneous databases

ChiTaRSiQSER1 human
GenomeRNAii79832
PROiPR:Q2KHR3

Gene expression databases

BgeeiENSG00000060749 Expressed in 213 organ(s), highest expression level in caput epididymis
CleanExiHS_QSER1
ExpressionAtlasiQ2KHR3 baseline and differential
GenevisibleiQ2KHR3 HS

Family and domain databases

InterProiView protein in InterPro
IPR025451 DUF4211
PfamiView protein in Pfam
PF13926 DUF4211, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiQSER1_HUMAN
AccessioniPrimary (citable) accession number: Q2KHR3
Secondary accession number(s): Q6ZU30, Q6ZUR5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: October 5, 2010
Last modified: November 7, 2018
This is version 99 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again