Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 104 (31 Jul 2019)
Sequence version 3 (05 Oct 2010)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Glutamine and serine-rich protein 1

Gene

QSER1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Glutamine and serine-rich protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:QSER1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26154 QSER1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q2KHR3

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000060749

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA143485589

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
QSER1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
308153569

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002889331 – 1735Glutamine and serine-rich protein 1Add BLAST1735

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei586PhosphoserineCombined sources1
Modified residuei615PhosphoserineCombined sources1
Modified residuei886PhosphoserineCombined sources1
Modified residuei949PhosphothreonineCombined sources1
Modified residuei987PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki1058Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1083Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei1211PhosphoserineCombined sources1
Modified residuei1230PhosphoserineCombined sources1
Modified residuei1231PhosphoserineCombined sources1
Modified residuei1239PhosphoserineCombined sources1
Modified residuei1341PhosphothreonineCombined sources1
Modified residuei1348PhosphoserineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q2KHR3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q2KHR3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q2KHR3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q2KHR3

PeptideAtlas

More...
PeptideAtlasi
Q2KHR3

PRoteomics IDEntifications database

More...
PRIDEi
Q2KHR3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
61307 [Q2KHR3-1]
61308 [Q2KHR3-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q2KHR3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q2KHR3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000060749 Expressed in 213 organ(s), highest expression level in caput epididymis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q2KHR3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q2KHR3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA005682

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122924, 30 interactors

Protein interaction database and analysis system

More...
IntActi
Q2KHR3, 18 interactors

Molecular INTeraction database

More...
MINTi
Q2KHR3

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000382241

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi120 – 527Ser-richAdd BLAST408
Compositional biasi641 – 789Gln-richAdd BLAST149

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4805 Eukaryota
ENOG410XTD1 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00440000037417

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000232191

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q2KHR3

Identification of Orthologs from Complete Genome Data

More...
OMAi
GEGMYRE

Database of Orthologous Groups

More...
OrthoDBi
64109at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q2KHR3

TreeFam database of animal gene trees

More...
TreeFami
TF333141

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR025451 DUF4211

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13926 DUF4211, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q2KHR3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNFLSTAESR TAQAAASGTT LLPQFRAPSW QTGMHSSAAT ELFATGPLPS
60 70 80 90 100
TGTLPPSLSA YQHPTTFSNR NFATTSPLVL QDSTFNTTSN GILSHHDPLL
110 120 130 140 150
QIKTSQGTVP TALAFERLGS SVLSNSIPPQ SSTYRSAQES APHLLQPQFS
160 170 180 190 200
LLPSALGGSQ QTPQAYSSTL FTSSTASIER ALLRECSVIK HHQRPSGTQS
210 220 230 240 250
IQAQLTGSQH SLHSYLSNSS VVNFQETTRQ SSLSCSPIGD STQVSNGGLQ
260 270 280 290 300
QKTSQVSVEL AQSYSSAIPS SGYPPSTTKI KSCSTEQPLT STKTPKPQSI
310 320 330 340 350
IPPVQTLSYS KPLHNQSSVI SGQAQIYSTA QLPSLLSVSQ SQNYGLVQPH
360 370 380 390 400
NVPSIVHSQV YRSSKVEKLP PLYKTLTFSG SSQTVTPENQ TLNYSSNQQE
410 420 430 440 450
VLSSVTNENY PAQTRDLSSV SQSQSYSSGH SQGLSPVSQT QVSYSSQSQV
460 470 480 490 500
LSVVSLSESY ASGESLTLTA PSLSYSSASR AQNLPDSSPT QNYISMHSSQ
510 520 530 540 550
NVQTQESSSP QSQKFLPAVQ SSSFASSTHC QTLQNNITSP DPKSYAERKL
560 570 580 590 600
DSDVYPSSKQ EDGFPMQELQ VLQPQASLES STQRLSDGEI NAQESTYKVS
610 620 630 640 650
KADDRYSQSV IRSNSRLEDQ VIGVALQASK KEESVVGSVT QLNQQIGQVN
660 670 680 690 700
NAATLDLKNS TNLIQTPQIR LNTKDLKQQH PLILKVHESK VQEQHDQIIN
710 720 730 740 750
ASSQIQIPNH ALGHGHQASL PNTQVLLDSA CDLQILQQSI LQAGLGQVKA
760 770 780 790 800
SLQAQRVQSP QQIVHPFLQM EGHVIQSNGD HSQQQLHPQN SEVMKMDLSE
810 820 830 840 850
SSKPLQQHLT TKGHFSETNQ HDSKNQFVSL GSMCFPEAVL LSDERNILSN
860 870 880 890 900
VDDILAATAA ACGVTPTDFS KSTSNETMQA VEDGDSKSHF QQSLDVRHVT
910 920 930 940 950
SDFNSMTATV GKPQNINDTS LNGNQVTVNL SPVPALQSKM TLDQQHIETP
960 970 980 990 1000
GQNIPTKVTS AVVGPSHEVQ EQSSGPFKKQ SATNLESEED SEAPVDSTLN
1010 1020 1030 1040 1050
NNRNQEFVSS SRSISGENAT SESEFTLGGD DSGVSMNPAR SALALLAMAQ
1060 1070 1080 1090 1100
SGDAVSVKIE EENQDLMHFN LQKKRAKGKG QVKEEDNSNQ KQLKRPAQGK
1110 1120 1130 1140 1150
RQNPRGTDIY LPYTPPSSES CHDGYQHQEK MRQKIKEVEE KQPEVKTGFI
1160 1170 1180 1190 1200
ASFLDFLKSG PKQQFSTLAV RMPNRTRRPG TQMVRTFCPP PLPKPSSTTP
1210 1220 1230 1240 1250
TPLVSETGGN SPSDKVDNEL KNLEHLSSFS SDEDDPGYSQ DAYKSVSTPL
1260 1270 1280 1290 1300
TTLDATSDKK KKTEALQVAT TSPTANTTGT ATTSSTTVGA VKQEPLHSTS
1310 1320 1330 1340 1350
YAVNILENIS SSESSKPIEL DGLPSDQFAK GQDTVAIEGF TDEEDTESGG
1360 1370 1380 1390 1400
EGQYRERDEF VVKIEDIETF KEALKTGKEP PAIWKVQKAL LQKFVPEIRD
1410 1420 1430 1440 1450
GQREFAATNS YLGYFGDAKS KYKRIYVKFI ENANKKEYVR VCSKKPRNKP
1460 1470 1480 1490 1500
SQTIRTVQAK PSSSSKTSDP LASKTTTTKA PSVKPKVKQP KVKAEPPPKK
1510 1520 1530 1540 1550
RKKWKEEFSS SQSDSSPEIH TSSSDDEEFE PPAPFVTRFL NTRAMKETFK
1560 1570 1580 1590 1600
SYMELLVSIA LDPDTMQALE KSNDELLLPH MKKIDGMLND NRKRLLLNLH
1610 1620 1630 1640 1650
LDQSFKNALE SFPELTIITR DSKAKSGGTA ISKIKMNGKA YNKKTLRTSK
1660 1670 1680 1690 1700
TTTKSAQEFA VDPEKIQLYS LYHSLHHYKY HVYLICKDEI SSVQKKNEDL
1710 1720 1730
GQEEIVQLCM KNVKWVEDLF EKFGELLNHV QQKCS
Length:1,735
Mass (Da):189,972
Last modified:October 5, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9FC28818DBB42A92
GO
Isoform 2 (identifier: Q2KHR3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     243-481: Missing.
     1730-1735: VQQKCS → TGMLGEMQSVSVSSTRRSEQQNILEAGKSKIKVPVSGDC

Note: No experimental confirmation available.
Show »
Length:1,529
Mass (Da):168,003
Checksum:i811508C5F1B2FC4F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YCQ7H0YCQ7_HUMAN
Glutamine and serine-rich protein 1
QSER1
780Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3IRW6A0A3B3IRW6_HUMAN
Glutamine and serine-rich protein 1
QSER1
1,864Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ISY4A0A3B3ISY4_HUMAN
Glutamine and serine-rich protein 1
QSER1
150Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAI12936 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAC86397 differs from that shown. Reason: Erroneous termination at position 1555. Translated as Leu.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti291S → P in AK125391 (PubMed:14702039).Curated1
Sequence conflicti486D → N in AK125391 (PubMed:14702039).Curated1
Sequence conflicti1075R → G in AK125391 (PubMed:14702039).Curated1
Sequence conflicti1247S → P in AK125391 (PubMed:14702039).Curated1
Sequence conflicti1258D → E in AK125391 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_056975385V → I2 PublicationsCorresponds to variant dbSNP:rs1022586Ensembl.1
Natural variantiVAR_032535644Q → R. Corresponds to variant dbSNP:rs2297781Ensembl.1
Natural variantiVAR_0325361018N → SCombined sources2 PublicationsCorresponds to variant dbSNP:rs7940077Ensembl.1
Natural variantiVAR_0325371304N → D. Corresponds to variant dbSNP:rs16923676Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_039815243 – 481Missing in isoform 2. 1 PublicationAdd BLAST239
Alternative sequenceiVSP_0398161730 – 1735VQQKCS → TGMLGEMQSVSVSSTRRSEQ QNILEAGKSKIKVPVSGDC in isoform 2. 1 Publication6

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK125391 mRNA No translation available.
AK126023 mRNA Translation: BAC86397.1 Sequence problems.
AC107939 Genomic DNA No translation available.
BC112935 mRNA Translation: AAI12936.1 Sequence problems.

NCBI Reference Sequences

More...
RefSeqi
NP_001070254.1, NM_001076786.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000399302; ENSP00000382241; ENSG00000060749 [Q2KHR3-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79832

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79832

UCSC genome browser

More...
UCSCi
uc001mty.4 human [Q2KHR3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK125391 mRNA No translation available.
AK126023 mRNA Translation: BAC86397.1 Sequence problems.
AC107939 Genomic DNA No translation available.
BC112935 mRNA Translation: AAI12936.1 Sequence problems.
RefSeqiNP_001070254.1, NM_001076786.2

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi122924, 30 interactors
IntActiQ2KHR3, 18 interactors
MINTiQ2KHR3
STRINGi9606.ENSP00000382241

PTM databases

iPTMnetiQ2KHR3
PhosphoSitePlusiQ2KHR3

Polymorphism and mutation databases

BioMutaiQSER1
DMDMi308153569

Proteomic databases

EPDiQ2KHR3
jPOSTiQ2KHR3
MaxQBiQ2KHR3
PaxDbiQ2KHR3
PeptideAtlasiQ2KHR3
PRIDEiQ2KHR3
ProteomicsDBi61307 [Q2KHR3-1]
61308 [Q2KHR3-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000399302; ENSP00000382241; ENSG00000060749 [Q2KHR3-1]
GeneIDi79832
KEGGihsa:79832
UCSCiuc001mty.4 human [Q2KHR3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79832

GeneCards: human genes, protein and diseases

More...
GeneCardsi
QSER1
HGNCiHGNC:26154 QSER1
HPAiHPA005682
neXtProtiNX_Q2KHR3
OpenTargetsiENSG00000060749
PharmGKBiPA143485589

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4805 Eukaryota
ENOG410XTD1 LUCA
GeneTreeiENSGT00440000037417
HOGENOMiHOG000232191
InParanoidiQ2KHR3
OMAiGEGMYRE
OrthoDBi64109at2759
PhylomeDBiQ2KHR3
TreeFamiTF333141

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
QSER1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79832

Protein Ontology

More...
PROi
PR:Q2KHR3

Gene expression databases

BgeeiENSG00000060749 Expressed in 213 organ(s), highest expression level in caput epididymis
ExpressionAtlasiQ2KHR3 baseline and differential
GenevisibleiQ2KHR3 HS

Family and domain databases

InterProiView protein in InterPro
IPR025451 DUF4211
PfamiView protein in Pfam
PF13926 DUF4211, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiQSER1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q2KHR3
Secondary accession number(s): Q6ZU30, Q6ZUR5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: October 5, 2010
Last modified: July 31, 2019
This is version 104 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again