Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 104 (02 Jun 2021)
Sequence version 1 (04 Apr 2006)
Previous versions | rss
Add a publicationFeedback
Protein

Sulfotransferase 2B1

Gene

Sult2b1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfonates cholesterol (PubMed:16368200).

Catalyzes sulfation of the 3beta-hydroxyl groups of steroids, such as, pregnenolone and dehydroepiandrosterone (DHEA) (PubMed:16368200).

Conjugates efficiently cholesterol but has a greater affinity for pregnenolone sulfation. Does not show high activity with DHEA (PubMed:16368200).

Plays a role in epidermal cholesterol metabolism and in the regulation of epidermal proliferation and differentiation (By similarity).

By similarity1 Publication

Prefers pregnenolone over DHEA as a substrate and does not sulfate cholesterol.

1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=8.9 µM for pregnenolone (isoform 2)1 Publication
  2. KM=17.9 µM for dehydroepiandrosterone (DHEA) (isoform 2)1 Publication
  3. KM=1.7 µM for cholesterol (isoform 1)1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei95SubstrateBy similarity1
    Binding sitei100SubstrateBy similarity1
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei122Proton acceptorBy similarity1
    Binding sitei144PAPSBy similarity1
    Binding sitei152PAPSBy similarity1
    Binding sitei207PAPSBy similarity1

    Regions

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi67 – 72PAPSBy similarity6
    Nucleotide bindingi241 – 246PAPSBy similarity6
    Nucleotide bindingi271 – 273PAPSBy similarity3

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionTransferase
    Biological processLipid metabolism, Steroid metabolism

    Enzyme and pathway databases

    BRENDA Comprehensive Enzyme Information System

    More...
    BRENDAi
    2.8.2.2, 5301

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-RNO-156584, Cytosolic sulfonation of small molecules

    SABIO-RK: Biochemical Reaction Kinetics Database

    More...
    SABIO-RKi
    Q29YR5

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Sulfotransferase 2B1 (EC:2.8.2.21 Publication)
    Alternative name(s):
    Alcohol sulfotransferase
    Hydroxysteroid sulfotransferase 2
    Sulfotransferase family cytosolic 2B member 1
    Short name:
    ST2B1
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:Sult2b1Imported
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
    <p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

    Organism-specific databases

    Rat genome database

    More...
    RGDi
    1308882, Sult2b1

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Keywords - Cellular componenti

    Cytoplasm, Endoplasmic reticulum, Microsome, Nucleus

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002444881 – 340Sulfotransferase 2B1Add BLAST340

    Proteomic databases

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    Q29YR5

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    Q29YR5

    PRoteomics IDEntifications database

    More...
    PRIDEi
    Q29YR5

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    Q29YR5

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    Q29YR5

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Isoform 1 is expressed in skin and testis. Higher level of isoform 2 expressed in skin and intestine, moderate level in the kidney, low level in liver, stomach and placenta.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSRNOG00000021046, Expressed in jejunum and 21 other tissues

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    Q29YR5, RN

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    Protein-protein interaction databases

    STRING: functional protein association networks

    More...
    STRINGi
    10116.ENSRNOP00000060264

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    Q29YR5

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni301 – 340DisorderedSequence analysisAdd BLAST40

    <p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the sulfotransferase 1 family.Curated

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG1584, Eukaryota

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000159269

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    CLU_027239_1_0_1

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    Q29YR5

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    FCDGNCT

    Database of Orthologous Groups

    More...
    OrthoDBi
    780670at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    Q29YR5

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF321745

    Family and domain databases

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR027417, P-loop_NTPase
    IPR000863, Sulfotransferase_dom

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF00685, Sulfotransfer_1, 1 hit

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF52540, SSF52540, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
    Isoform 11 Publication (identifier: Q29YR5-1) [UniParc]FASTAAdd to basket
    Also known as: SULT2B1b1 Publication

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MDGPQPPALW GSLENRVSEL SQKLQGEYFR YKGIPFPVGM YTPESLSLAE
    60 70 80 90 100
    NTSNVRDDDI FIVTYPKSGT NWMIEIICLI LKDGDPSWIR SEPIWQRAPW
    110 120 130 140 150
    CETTISAFSL PERPSPRLMC SHLPIELFTK AAFSSKAKVI YLGRNPRDVV
    160 170 180 190 200
    VSLYYYSKIA VQLKDPGTPE QFLQNFLKGE VQFGSWFDHI KGWIRMRGRE
    210 220 230 240 250
    NFLFITYEEL QQDLRGSVQL ICEFLGRPLG EEALSSVVAH SAFAAMKANN
    260 270 280 290 300
    MSNYTLLPAS LLDHRQGAFL RKGISGDWKN HFTVAQSETF DQVYREQMHG
    310 320 330 340
    LPSFPWDRSA EDGSPDGETE PSPSPSPGLA SDDPNPGSSQ
    Length:340
    Mass (Da):38,322
    Last modified:April 4, 2006 - v1
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9B3496466393A361
    GO
    Isoform 21 Publication (identifier: Q29YR5-2) [UniParc]FASTAAdd to basket
    Also known as: SULT2B1a1 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         1-20: MDGPQPPALWGSLENRVSEL → MSPWSRNTCYSSPSMRLDRSCARNTARWGHWKEGKPHGGLTGETEAGSSWNGGSE

    Show »
    Length:375
    Mass (Da):42,181
    Checksum:i1F7A47B1EC2B3EE7
    GO

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0520791 – 20MDGPQ…RVSEL → MSPWSRNTCYSSPSMRLDRS CARNTARWGHWKEGKPHGGL TGETEAGSSWNGGSE in isoform 2. 1 PublicationAdd BLAST20

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    AY827147 mRNA Translation: AAX34390.1
    AY827148 mRNA Translation: AAX34391.1

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001034754.1, NM_001039665.1 [Q29YR5-2]
    XP_006229093.1, XM_006229031.3 [Q29YR5-1]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENSRNOT00000028570; ENSRNOP00000028570; ENSRNOG00000021046 [Q29YR5-1]
    ENSRNOT00000067430; ENSRNOP00000060264; ENSRNOG00000021046 [Q29YR5-2]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    292915

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    rno:292915

    UCSC genome browser

    More...
    UCSCi
    RGD:1308882, rat [Q29YR5-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AY827147 mRNA Translation: AAX34390.1
    AY827148 mRNA Translation: AAX34391.1
    RefSeqiNP_001034754.1, NM_001039665.1 [Q29YR5-2]
    XP_006229093.1, XM_006229031.3 [Q29YR5-1]

    3D structure databases

    SMRiQ29YR5
    ModBaseiSearch...

    Protein-protein interaction databases

    STRINGi10116.ENSRNOP00000060264

    PTM databases

    iPTMnetiQ29YR5
    PhosphoSitePlusiQ29YR5

    Proteomic databases

    jPOSTiQ29YR5
    PaxDbiQ29YR5
    PRIDEiQ29YR5

    Genome annotation databases

    EnsembliENSRNOT00000028570; ENSRNOP00000028570; ENSRNOG00000021046 [Q29YR5-1]
    ENSRNOT00000067430; ENSRNOP00000060264; ENSRNOG00000021046 [Q29YR5-2]
    GeneIDi292915
    KEGGirno:292915
    UCSCiRGD:1308882, rat [Q29YR5-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    6820
    RGDi1308882, Sult2b1

    Phylogenomic databases

    eggNOGiKOG1584, Eukaryota
    GeneTreeiENSGT00940000159269
    HOGENOMiCLU_027239_1_0_1
    InParanoidiQ29YR5
    OMAiFCDGNCT
    OrthoDBi780670at2759
    PhylomeDBiQ29YR5
    TreeFamiTF321745

    Enzyme and pathway databases

    BRENDAi2.8.2.2, 5301
    ReactomeiR-RNO-156584, Cytosolic sulfonation of small molecules
    SABIO-RKiQ29YR5

    Miscellaneous databases

    Protein Ontology

    More...
    PROi
    PR:Q29YR5

    Gene expression databases

    BgeeiENSRNOG00000021046, Expressed in jejunum and 21 other tissues
    GenevisibleiQ29YR5, RN

    Family and domain databases

    InterProiView protein in InterPro
    IPR027417, P-loop_NTPase
    IPR000863, Sulfotransferase_dom
    PfamiView protein in Pfam
    PF00685, Sulfotransfer_1, 1 hit
    SUPFAMiSSF52540, SSF52540, 1 hit

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiST2B1_RAT
    <p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q29YR5
    Secondary accession number(s): Q29YR6
    <p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
    Last sequence update: April 4, 2006
    Last modified: June 2, 2021
    This is version 104 of the entry and version 1 of the sequence. See complete history.
    <p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    <p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again