Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 109 (08 May 2019)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Sodium channel protein type 9 subunit alpha

Gene

SCN9A

Organism
Oryctolagus cuniculus (Rabbit)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na+ ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-sensitive Na+ channel isoform. Plays a role in pain mechanisms, especially in the development of inflammatory pain.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel, Sodium channel, Voltage-gated channel
Biological processIon transport, Sodium transport, Transport
LigandSodium

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sodium channel protein type 9 subunit alphaBy similarity
Alternative name(s):
Nas1 Publication
Schwann cell sodium channel
Sodium channel protein type IX subunit alpha
Voltage-gated sodium channel subunit alpha Nav1.7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SCN9ABy similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiOryctolagus cuniculus (Rabbit)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9986 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresLagomorphaLeporidaeOryctolagus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001811 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 126CytoplasmicCuratedAdd BLAST126
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei127 – 145Helical; Name=S1 of repeat IBy similarityAdd BLAST19
Topological domaini146 – 152ExtracellularCurated7
Transmembranei153 – 173Helical; Name=S2 of repeat IBy similarityAdd BLAST21
Topological domaini174 – 187CytoplasmicCuratedAdd BLAST14
Transmembranei188 – 205Helical; Name=S3 of repeat IBy similarityAdd BLAST18
Topological domaini206 – 211ExtracellularCurated6
Transmembranei212 – 228Helical; Name=S4 of repeat IBy similarityAdd BLAST17
Topological domaini229 – 247CytoplasmicCuratedAdd BLAST19
Transmembranei248 – 267Helical; Name=S5 of repeat IBy similarityAdd BLAST20
Topological domaini268 – 344ExtracellularCuratedAdd BLAST77
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei345 – 369Pore-formingBy similarityAdd BLAST25
Topological domaini370 – 376ExtracellularCurated7
Transmembranei377 – 397Helical; Name=S6 of repeat IBy similarityAdd BLAST21
Topological domaini398 – 741CytoplasmicCuratedAdd BLAST344
Transmembranei742 – 760Helical; Name=S1 of repeat IIBy similarityAdd BLAST19
Topological domaini761 – 771ExtracellularCuratedAdd BLAST11
Transmembranei772 – 791Helical; Name=S2 of repeat IIBy similarityAdd BLAST20
Topological domaini792 – 805CytoplasmicCuratedAdd BLAST14
Transmembranei806 – 825Helical; Name=S3 of repeat IIBy similarityAdd BLAST20
Topological domaini826 – 827ExtracellularCurated2
Transmembranei828 – 845Helical; Name=S4 of repeat IIBy similarityAdd BLAST18
Topological domaini846 – 861CytoplasmicCuratedAdd BLAST16
Transmembranei862 – 880Helical; Name=S5 of repeat IIBy similarityAdd BLAST19
Topological domaini881 – 909ExtracellularCuratedAdd BLAST29
Intramembranei910 – 930Pore-formingBy similarityAdd BLAST21
Topological domaini931 – 943ExtracellularCuratedAdd BLAST13
Transmembranei944 – 964Helical; Name=S6 of repeat IIBy similarityAdd BLAST21
Topological domaini965 – 1190CytoplasmicCuratedAdd BLAST226
Transmembranei1191 – 1208Helical; Name=S1 of repeat IIIBy similarityAdd BLAST18
Topological domaini1209 – 1221ExtracellularCuratedAdd BLAST13
Transmembranei1222 – 1240Helical; Name=S2 of repeat IIIBy similarityAdd BLAST19
Topological domaini1241 – 1254CytoplasmicCuratedAdd BLAST14
Transmembranei1255 – 1273Helical; Name=S3 of repeat IIIBy similarityAdd BLAST19
Topological domaini1274 – 1281ExtracellularCurated8
Transmembranei1282 – 1300Helical; Name=S4 of repeat IIIBy similarityAdd BLAST19
Topological domaini1301 – 1317CytoplasmicCuratedAdd BLAST17
Transmembranei1318 – 1337Helical; Name=S5 of repeat IIIBy similarityAdd BLAST20
Topological domaini1338 – 1389ExtracellularCuratedAdd BLAST52
Intramembranei1390 – 1411Pore-formingBy similarityAdd BLAST22
Topological domaini1412 – 1428ExtracellularCuratedAdd BLAST17
Transmembranei1429 – 1450Helical; Name=S6 of repeat IIIBy similarityAdd BLAST22
Topological domaini1451 – 1513CytoplasmicCuratedAdd BLAST63
Transmembranei1514 – 1531Helical; Name=S1 of repeat IVBy similarityAdd BLAST18
Topological domaini1532 – 1542ExtracellularCuratedAdd BLAST11
Transmembranei1543 – 1561Helical; Name=S2 of repeat IVBy similarityAdd BLAST19
Topological domaini1562 – 1573CytoplasmicCuratedAdd BLAST12
Transmembranei1574 – 1591Helical; Name=S3 of repeat IVBy similarityAdd BLAST18
Topological domaini1592 – 1604ExtracellularCuratedAdd BLAST13
Transmembranei1605 – 1621Helical; Name=S4 of repeat IVBy similarityAdd BLAST17
Topological domaini1622 – 1640CytoplasmicCuratedAdd BLAST19
Transmembranei1641 – 1658Helical; Name=S5 of repeat IVBy similarityAdd BLAST18
Topological domaini1659 – 1680ExtracellularCuratedAdd BLAST22
Intramembranei1681 – 1703Pore-formingBy similarityAdd BLAST23
Topological domaini1704 – 1733ExtracellularCuratedAdd BLAST30
Transmembranei1734 – 1756Helical; Name=S6 of repeat IVBy similarityAdd BLAST23
Topological domaini1757 – 1984CytoplasmicCuratedAdd BLAST228

Keywords - Cellular componenti

Cell membrane, Cell projection, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000485041 – 1984Sodium channel protein type 9 subunit alphaAdd BLAST1984

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi209N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi275 ↔ 322By similarity
Glycosylationi281N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi892Interchain; with SCN2B or SCN4BBy similarity
Disulfide bondi892Interchain; with the conotoxin GVIIJ (when the channel is not linked to SCN2B or SCN4B; the bond to SCN2B or SCN4B protects the channel from the inhibition by toxin)By similarity
Disulfide bondi932 ↔ 941By similarity
Glycosylationi1349N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1363N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1372N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1487Phosphoserine; by PKCBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation at Ser-1487 by PKC in a highly conserved cytoplasmic loop increases peak sodium currents.By similarity
Ubiquitinated by NEDD4L; which may promote its endocytosis. Does not seem to be ubiquitinated by NEDD4.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein, Ubl conjugation

Proteomic databases

PRoteomics IDEntifications database

More...
PRIDEi
Q28644

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the sciatic nerve, spinal cord, brainstem, cerebellum and cortex, but not expressed in the lung, skeletal and cardiac muscles, kidney and liver.1 Publication

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The sodium channel complex consists of a large, channel-forming alpha subunit and 2-3 smaller, ancillary beta subunits (By similarity).

Interacts with NEDD4 and NEDD4L (By similarity).

Interacts with the conotoxin GVIIJ (By similarity).

By similarity

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9986.ENSOCUP00000020201

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati112 – 408ICuratedAdd BLAST297
Repeati723 – 986IICuratedAdd BLAST264
Repeati1177 – 1485IIICuratedAdd BLAST309
Repeati1494 – 1792IVCuratedAdd BLAST299
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1886 – 1915IQAdd BLAST30

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The sequence contains 4 internal repeats, each with 5 hydrophobic segments (S1, S2, S3, S5, S6) and one positively charged segment (S4). Segments S4 are probably the voltage-sensors and are characterized by a series of positively charged amino acids at every third position.Curated

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410KCTY Eukaryota
COG1226 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231755

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q28644

KEGG Orthology (KO)

More...
KOi
K04841

Database of Orthologous Groups

More...
OrthoDBi
56920at2759

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.120.350, 4 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR005821 Ion_trans_dom
IPR000048 IQ_motif_EF-hand-BS
IPR001696 Na_channel_asu
IPR010526 Na_trans_assoc
IPR024583 Na_trans_cytopl
IPR028803 SCN9A
IPR027359 Volt_channel_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10037:SF221 PTHR10037:SF221, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00520 Ion_trans, 4 hits
PF06512 Na_trans_assoc, 1 hit
PF11933 Na_trans_cytopl, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00170 NACHANNEL

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00015 IQ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q28644-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAMLPPPGPQ SFVRFTKQSL ALIEQRIAEG KTKEPKEEKK DDHDEGPKPS
60 70 80 90 100
SDLEAGKQLP FIYGDIPAGM VSEPLEDLDP YYADKKTFIV LNKGKAIFRF
110 120 130 140 150
NATPALYILS PFSPLRRISI KILVHSLFSM LIMCTILTNC IFMTMNNPAE
160 170 180 190 200
WTKNVEYTFT GIYTFESLVK IFARGFCVGE FTFLRDPWNW LDFIVIVFAY
210 220 230 240 250
LTEFVNLGNV SALRTFRVLR ALKTISVIPG LKTIVGALIQ SVKKLSDVII
260 270 280 290 300
LTVFCLSVFA LIGLQLFMGH LKHKCLRKIE NETLESIMSS IESEEDYKKY
310 320 330 340 350
FYYLEGSKDA LLCGFSTDSG QCPEGYYCVK AGRNPDYGYT SFDTFSWAFL
360 370 380 390 400
ALFRLMTQDY WENLYQQTLR AAGKTYMIFF VVVIFLGSFY LINLILAVVA
410 420 430 440 450
MAYEEQNQAN IEEAKQKELE FQQMLDRLKK EQEEAEAIAA AAAEYTSIGR
460 470 480 490 500
SRIMGLSESS SETSKLSSKS AKERRNRRKK KNQKKLSSGE EKGDDEKLSK
510 520 530 540 550
SESEESISRK QFHLGVEGHR LAREKRLSAP NQSPLSIRGS LFSARRSSRT
560 570 580 590 600
SLFSFKGRGK DIGSETEFAD DEHSIFGDNE SRRGSLFVPQ RPQERRSSNL
610 620 630 640 650
SQASRSPPML QMNGKMHSAV DCNGVVSLVD GPSALMLPNG QLLPEVIIDK
660 670 680 690 700
ATSDDSGTTQ IRKKRRSSSY LLSEDMLNDP HLRQRAMSRA SILTNTVEEL
710 720 730 740 750
EESRQKCPSW WYRFAHTFLI WNCSPFWIKF KKFIYIIVMD PFVDLAITIC
760 770 780 790 800
IVLNTLFMAM EHHPMTEEFK NVLVVGNLVF TGIFAAEMVL KLIAMDPYEY
810 820 830 840 850
FQVGWNVFDS LIVTLSLVEL FLADVEGLSV LRSFRLLRVF KLAKSWPTLN
860 870 880 890 900
MLIKIIGNSV GPLGNLTLVL AIIVFIFAVV GMQLFGKSYK ECVCKINDDC
910 920 930 940 950
SLPRWHMNDF FHSFLIVFRV LCGEWIETMW DCMEVAGQAM CLIVYMMVMV
960 970 980 990 1000
IGNLVVLNLF LALLLSSFSS DNLSAIEEDT DANNLQIAVT RIKKGINYVK
1010 1020 1030 1040 1050
QTLRELILKA FSKKPKISKE IRQAEDLNSK KENYISNRTL AEMSKDYNFH
1060 1070 1080 1090 1100
KEKDKISGFG SSMDKYLMEE SDHQSFIHNP SLTVTVPIAP GESDLENMNT
1110 1120 1130 1140 1150
EELSSDSESE YSKERLNRSS SSECSTVDNA LPGEGEEAEA EPVNSDEPEA
1160 1170 1180 1190 1200
CFTDGCVRRF PCCQVSIESG KGKIWWNIRK TCYRIVEHSW FESFIVLMIL
1210 1220 1230 1240 1250
LSSGALAFED IYIEKKKTIK IILEYADKIF TYIFILEMLL KWVAYGYKTY
1260 1270 1280 1290 1300
FTNAWCWLDF LIVDVSLVTL VANTLGYSDL GPIKSLRTLR ALRPLRALSR
1310 1320 1330 1340 1350
FEGMRVVVNA LIGAIPSIMN VLLVCLIFWL IFSIMGVNLF AGKFYQCVNT
1360 1370 1380 1390 1400
TDDSRFPTKQ VSNRSECFAL MNGSQNVRWK NLKVNFDNVG LRYLSLLQVA
1410 1420 1430 1440 1450
TFKGWMDIMY AAVDSVNVDQ QPSYEHNLYM YIYFVIFIIF GSFFTLNLFI
1460 1470 1480 1490 1500
GVIIDNFNQQ KKKLGGQDIF MTEEQKKYYN AMKKLGSKKP QKPIPRPGNK
1510 1520 1530 1540 1550
FQGCIFDLVT NQAFDITIMI LICLNMVTMM VEKEGQSDYM TDVLYWINVV
1560 1570 1580 1590 1600
FIILFTGECV LKLISLRHYY FTIGWNIFDF VVVILSIVGM FLAELIETYF
1610 1620 1630 1640 1650
VSPTLFRVIR LARIGRILRL IKGAKGIRTL LFALMMSLPA LFNIGLLLFL
1660 1670 1680 1690 1700
VMFIYAIFGM SNFAYVKKEA GINDMFNFET FGNSMICLFQ ITTSAGWDGL
1710 1720 1730 1740 1750
LAPILNSAPP DCDPKKVHPG SSTEGDCGSP SVGIFYFVSY IIISFLVVVN
1760 1770 1780 1790 1800
MYIAVILENF SVATEESTEP LSEDDFEMFY EVWEKFDPDA TQFIEYSKLS
1810 1820 1830 1840 1850
DFAAALDPPL LIAKPNKVQL IAMDLPMVSG DRIHCLDILF AFTKRVLGES
1860 1870 1880 1890 1900
GEMDSLRSQM EERFMSANPS KVSYEPITTT LKRKQEDVSA TVIQRAYRRY
1910 1920 1930 1940 1950
RLRQNVKNIS SIYIKEGDKD DDLPNKGDIV FDNVNSSSPE KTDATASTIS
1960 1970 1980
PPSYDSVTKP DKEKYEKDKT EKEDKGKDGK ETKK
Length:1,984
Mass (Da):225,751
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i98F76860C9866AA0
GO
Isoform 2 (identifier: Q28644-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     200-229: YLTEFVNLGNVSALRTFRVLRALKTISVIP → YVTEFVDLGNVSALRTFRVLRALKTISVIP

Show »
Length:1,984
Mass (Da):225,738
Checksum:iA05CB05A33027C1C
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_012030200 – 229YLTEF…ISVIP → YVTEFVDLGNVSALRTFRVL RALKTISVIP in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U35238 mRNA Translation: AAA89159.1

NCBI Reference Sequences

More...
RefSeqi
NP_001075827.1, NM_001082358.1 [Q28644-1]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
100009210

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ocu:100009210

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U35238 mRNA Translation: AAA89159.1
RefSeqiNP_001075827.1, NM_001082358.1 [Q28644-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi9986.ENSOCUP00000020201

Proteomic databases

PRIDEiQ28644

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi100009210
KEGGiocu:100009210

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6335

Phylogenomic databases

eggNOGiENOG410KCTY Eukaryota
COG1226 LUCA
HOGENOMiHOG000231755
InParanoidiQ28644
KOiK04841
OrthoDBi56920at2759

Family and domain databases

Gene3Di1.20.120.350, 4 hits
InterProiView protein in InterPro
IPR005821 Ion_trans_dom
IPR000048 IQ_motif_EF-hand-BS
IPR001696 Na_channel_asu
IPR010526 Na_trans_assoc
IPR024583 Na_trans_cytopl
IPR028803 SCN9A
IPR027359 Volt_channel_dom_sf
PANTHERiPTHR10037:SF221 PTHR10037:SF221, 1 hit
PfamiView protein in Pfam
PF00520 Ion_trans, 4 hits
PF06512 Na_trans_assoc, 1 hit
PF11933 Na_trans_cytopl, 1 hit
PRINTSiPR00170 NACHANNEL
SMARTiView protein in SMART
SM00015 IQ, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSCN9A_RABIT
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q28644
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 23, 2004
Last sequence update: November 1, 1996
Last modified: May 8, 2019
This is version 109 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again