Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 165 (10 Feb 2021)
Sequence version 2 (10 May 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Protein bunched, class 1/class 3/D/E isoforms

Gene

bun

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable transcription factor required for peripheral nervous system morphogenesis, eye development and oogenesis. May be required for the transmission of the dpp signal and for a morphogenetic movement of the medulla in the brain that reorients the second optic lobe relative to the first. Plays a role in determining proper dorsal cell fates leading to the formation of the dorsal appendages.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • protein homodimerization activity Source: FlyBase

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Oogenesis, Transcription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein bunched, class 1/class 3/D/E isoforms
Alternative name(s):
Protein shortsighted
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:bun
Synonyms:shs
ORF Names:CG42281
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2L

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0259176, bun

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002193761 – 219Protein bunched, class 1/class 3/D/E isoformsAdd BLAST219

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Anterior dorsal follicle cells at stages 10-12 of oogenesis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0259176, Expressed in central nervous system and 55 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q24522, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q24522, DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
60711, 32 interactors

Protein interaction database and analysis system

More...
IntActi
Q24522, 6 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q24522

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni82 – 103Leucine-zipperAdd BLAST22

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi122 – 209Ala-richAdd BLAST88

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TSC-22/Dip/Bun family.Curated

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000168943

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000580, TSC-22_Dip_Bun

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01166, TSC22, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01289, TSC22, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform Class 1 (identifier: Q24522-1) [UniParc]FASTAAdd to basket
Also known as: B

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKTETGSNNN NTTVVNMDFD MYPSISGKQQ DPVREVVMKY IDYFLPDASG
60 70 80 90 100
TSAVAIDNKI EQAMDLVKSH LMIAVREEVE VLKERISELM DKINKLELEN
110 120 130 140 150
SILKSNIPQE TLQQLQLQLQ LAAPPATPAI QAAPAVQSVV APAAAGQAVQ
160 170 180 190 200
QQAAGAVAVT GVATSPASAV VPTSIPNGSA ENGSSAVESA AVSVEQQVQQ
210
VTSAAAAAAS VVTANGPMS
Length:219
Mass (Da):22,742
Last modified:May 10, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i29B3C20698C38743
GO
Isoform Class 3 (identifier: Q24522-2) [UniParc] [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     1-64: MKTETGSNNN...AIDNKIEQAM → MMGTMSLRQPENWLYEIWQKGYDSPCYVMVPNAK

Show »
Length:189
Mass (Da):19,687
Checksum:i068C40870CA12CAC
GO
Isoform D (identifier: Q24522-3) [UniParc]FASTAAdd to basket
Also known as: H

The sequence of this isoform differs from the canonical sequence as follows:
     2-47: KTETGSNNNN...MKYIDYFLPD → IKYPRTTSST...VRMFSTEVDN

Show »
Length:226
Mass (Da):23,543
Checksum:iE0BB59F88C1D6576
GO
Isoform E (identifier: Q24522-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: MKTETGSNNN...MKYIDYFLPD → MAALANKMAA...VYCFIKDFIG

Show »
Length:254
Mass (Da):26,424
Checksum:iFB2ECECF8652DCAF
GO
Isoform Class 2 (identifier: Q24523-1) [UniParc]FASTAAdd to basket
Also known as: A
The sequence of this isoform can be found in the external entry Q24523.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:1,206
Mass (Da):124,802
GO
Isoform F (identifier: Q24523-3) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q24523.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:1,097
Mass (Da):113,365
GO
Isoform G (identifier: Q24523-4) [UniParc]FASTAAdd to basket
The sequence of this isoform can be found in the external entry Q24523.
Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
Length:1,331
Mass (Da):138,064
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
X2J847X2J847_DROME
Bunched, isoform P
bun 1550, bnc, Bun, BunA, CG31857
1,137Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PCT7M9PCT7_DROME
Bunched, isoform O
bun 1550, bnc, Bun, BunA, CG31857
192Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB61239 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti30Q → E in AAB61239 (PubMed:9256356).Curated1
Sequence conflicti34R → C in AAB61239 (PubMed:9256356).Curated1
Sequence conflicti100N → H in AAB61239 (PubMed:9256356).Curated1
Sequence conflicti106N → K in AAB61239 (PubMed:9256356).Curated1
Sequence conflicti122 – 123AA → PR in AAB61239 (PubMed:9256356).Curated2
Sequence conflicti188E → G in AAB61239 (PubMed:9256356).Curated1
Sequence conflicti192V → G in AAB61239 (PubMed:9256356).Curated1
Sequence conflicti202 – 203TS → QQVTSAA in AAC41607 (PubMed:7555710).Curated2
Sequence conflicti202 – 203TS → QQVTSAA in AAB61239 (PubMed:9256356).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0102821 – 64MKTET…IEQAM → MMGTMSLRQPENWLYEIWQK GYDSPCYVMVPNAK in isoform Class 3. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_0358591 – 47MKTET…YFLPD → MAALANKMAANMATTSSSSN NNNIAGSESTLQQQQMLHHQ QQQQQQTQSNLIMPAAVIQP EYLLNNDRGLFKVYCFIKDF IG in isoform E. CuratedAdd BLAST47
Alternative sequenceiVSP_0358602 – 47KTETG…YFLPD → IKYPRTTSSTSSGYFDDDEA MMNPYQTPPASPQSVPQYLQ RHMVRMFSTEVDN in isoform D. CuratedAdd BLAST46

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L42511 mRNA Translation: AAC41607.1
AF003342 mRNA Translation: AAB61239.1 Different initiation.
AE014134 Genomic DNA Translation: AAF53200.3
AE014134 Genomic DNA Translation: AAN10817.1
AE014134 Genomic DNA Translation: ABI31312.1
AE014134 Genomic DNA Translation: ACZ94250.1
AE014134 Genomic DNA Translation: ACZ94251.1
AY060295 mRNA Translation: AAL25334.1

NCBI Reference Sequences

More...
RefSeqi
NP_001036358.1, NM_001042893.2 [Q24522-4]
NP_001162964.1, NM_001169493.2 [Q24522-3]
NP_001162965.1, NM_001169494.2 [Q24522-1]
NP_723755.2, NM_165012.2 [Q24522-3]
NP_723756.1, NM_165013.4 [Q24522-2]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0299652; FBpp0288927; FBgn0259176 [Q24522-3]
FBtr0299656; FBpp0288931; FBgn0259176 [Q24522-1]
FBtr0299657; FBpp0288932; FBgn0259176 [Q24522-2]
FBtr0300522; FBpp0289749; FBgn0259176 [Q24522-4]
FBtr0300524; FBpp0289751; FBgn0259176 [Q24522-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
34665

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L42511 mRNA Translation: AAC41607.1
AF003342 mRNA Translation: AAB61239.1 Different initiation.
AE014134 Genomic DNA Translation: AAF53200.3
AE014134 Genomic DNA Translation: AAN10817.1
AE014134 Genomic DNA Translation: ABI31312.1
AE014134 Genomic DNA Translation: ACZ94250.1
AE014134 Genomic DNA Translation: ACZ94251.1
AY060295 mRNA Translation: AAL25334.1
RefSeqiNP_001036358.1, NM_001042893.2 [Q24522-4]
NP_001162964.1, NM_001169493.2 [Q24522-3]
NP_001162965.1, NM_001169494.2 [Q24522-1]
NP_723755.2, NM_165012.2 [Q24522-3]
NP_723756.1, NM_165013.4 [Q24522-2]

3D structure databases

SMRiQ24522
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi60711, 32 interactors
IntActiQ24522, 6 interactors

Genome annotation databases

EnsemblMetazoaiFBtr0299652; FBpp0288927; FBgn0259176 [Q24522-3]
FBtr0299656; FBpp0288931; FBgn0259176 [Q24522-1]
FBtr0299657; FBpp0288932; FBgn0259176 [Q24522-2]
FBtr0300522; FBpp0289749; FBgn0259176 [Q24522-4]
FBtr0300524; FBpp0289751; FBgn0259176 [Q24522-3]
GeneIDi34665

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
34665
FlyBaseiFBgn0259176, bun

Phylogenomic databases

GeneTreeiENSGT00940000168943

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
34665, 1 hit in 3 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
bun, fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
34665

Gene expression databases

BgeeiFBgn0259176, Expressed in central nervous system and 55 other tissues
ExpressionAtlasiQ24522, baseline and differential
GenevisibleiQ24522, DM

Family and domain databases

InterProiView protein in InterPro
IPR000580, TSC-22_Dip_Bun
PfamiView protein in Pfam
PF01166, TSC22, 1 hit
PROSITEiView protein in PROSITE
PS01289, TSC22, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBUN1_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q24522
Secondary accession number(s): E1JH96
, E1JHG7, O02431, Q0E8Q8, Q0E8Q9, Q95T76
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 10, 2004
Last modified: February 10, 2021
This is version 165 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again