Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 177 (02 Dec 2020)
Sequence version 3 (01 Jun 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Ryanodine receptor

Gene

RyR

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Intracellular calcium channel that is required for proper muscle function during embryonic development and may be essential for excitation-contraction coupling in larval body wall muscles.2 Publications

Miscellaneous

Channel activity is modulated by the alkaloid ryanodine that binds to the open Ca-release channel with high affinity and maintains the channel in an open conformation. The calcium release channel is modulated by calcium ions, magnesium ions, ATP and calmodulin (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei4162Important for activation by Ca(2+)By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalcium channel, Developmental protein, Ion channel, Ligand-gated ion channel, Receptor
Biological processCalcium transport, Ion transport, Transport
LigandCalcium

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.A.3.1.5, the ryanodine-inositol 1,4,5-triphosphate receptor ca(2+) channel (rir-cac) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ryanodine receptor
Alternative name(s):
Ryanodine receptor 44F
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RyRImported
Synonyms:dry, Rya-r44FImported
ORF Names:CG10844Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2R

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0011286, RyR

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 4451CytoplasmicSequence analysisAdd BLAST4451
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei4452 – 4472HelicalSequence analysisAdd BLAST21
Transmembranei4651 – 4671HelicalSequence analysisAdd BLAST21
Transmembranei4683 – 4703HelicalSequence analysisAdd BLAST21
Transmembranei4742 – 4762HelicalSequence analysisAdd BLAST21
Transmembranei4885 – 4905HelicalSequence analysisAdd BLAST21
Transmembranei4924 – 4944HelicalSequence analysisAdd BLAST21
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei4974 – 4983Pore-formingBy similarity10
Transmembranei4984 – 5024HelicalSequence analysisAdd BLAST41
Topological domaini5025 – 5127CytoplasmicSequence analysisAdd BLAST103

Keywords - Cellular componenti

Membrane, Sarcoplasmic reticulum

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL6045

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002193641 – 5127Ryanodine receptorAdd BLAST5127

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1459Phosphoserine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q24498

PRoteomics IDEntifications database

More...
PRIDEi
Q24498

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q24498

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

During embryonic stages 9-10, expression is seen in mesoderm of all segments in progenitors of the cephalic and somatic muscles. Adults exhibit high expression in tubular 'jump' muscles of thorax and leg, and lower expression in the brain, ventral ganglion, head muscles and proboscis muscles.3 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Abundant in 6-12 hours embryos, reduced expression in second and third instar larval stages and adults.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0011286, Expressed in oviduct (Drosophila) and 32 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q24498, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q24498, DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotetramer.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
71972, 9 interactors

Protein interaction database and analysis system

More...
IntActi
Q24498, 13 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0293114

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q24498

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini94 – 148MIR 1PROSITE-ProRule annotationAdd BLAST55
Domaini155 – 200MIR 2PROSITE-ProRule annotationAdd BLAST46
Domaini210 – 264MIR 3PROSITE-ProRule annotationAdd BLAST55
Domaini270 – 328MIR 4PROSITE-ProRule annotationAdd BLAST59
Domaini336 – 394MIR 5PROSITE-ProRule annotationAdd BLAST59
Domaini577 – 803B30.2/SPRY 1PROSITE-ProRule annotationAdd BLAST227
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati845 – 9561By similarityAdd BLAST112
Repeati957 – 10752By similarityAdd BLAST119
Domaini1032 – 1217B30.2/SPRY 2PROSITE-ProRule annotationAdd BLAST186
Domaini1452 – 1673B30.2/SPRY 3PROSITE-ProRule annotationAdd BLAST222
Repeati2822 – 29453By similarityAdd BLAST124
Repeati2946 – 30634By similarityAdd BLAST118

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni845 – 30634 X approximate repeatsAdd BLAST2219

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi4686 – 4711Gly-richAdd BLAST26

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The calcium release channel activity resides in the C-terminal region while the remaining part of the protein resides in the cytoplasm.Curated

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2243, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000168850

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q24498

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q24498

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12877, SPRY1_RyR, 1 hit
cd12878, SPRY2_RyR, 1 hit
cd12879, SPRY3_RyR, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.120.920, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001870, B30.2/SPRY
IPR043136, B30.2/SPRY_sf
IPR013320, ConA-like_dom_sf
IPR011992, EF-hand-dom_pair
IPR014821, Ins145_P3_rcpt
IPR005821, Ion_trans_dom
IPR036300, MIR_dom_sf
IPR016093, MIR_motif
IPR013662, RIH_assoc-dom
IPR000699, RIH_dom
IPR013333, Ryan_recept
IPR003032, Ryanodine_rcpt
IPR009460, Ryanrecept_TM4-6
IPR035910, RyR/IP3R_RIH_dom_sf
IPR035761, SPRY1_RyR
IPR035764, SPRY2_RyR
IPR035762, SPRY3_RyR
IPR003877, SPRY_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08709, Ins145_P3_rec, 1 hit
PF00520, Ion_trans, 1 hit
PF02815, MIR, 1 hit
PF08454, RIH_assoc, 1 hit
PF06459, RR_TM4-6, 1 hit
PF01365, RYDR_ITPR, 2 hits
PF02026, RyR, 4 hits
PF00622, SPRY, 3 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00795, RYANODINER

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00472, MIR, 4 hits
SM00449, SPRY, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF100909, SSF100909, 1 hit
SSF47473, SSF47473, 1 hit
SSF49899, SSF49899, 2 hits
SSF82109, SSF82109, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50188, B302_SPRY, 3 hits
PS50919, MIR, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform A1 Publication (identifier: Q24498-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEAEGGSEQ DDVSFLRTED MVTLSCTATG ERVCLAAEGF GNRHCFLENI
60 70 80 90 100
ADKNVPPDLS QCVFVIEQAL SVRALQELVT AAGSETGKGT GSGHRTLLYG
110 120 130 140 150
NAILLRHHNS DMYLACLSTS SSNDKLSFDV GLQEHSQGEA CWWTVHPASK
160 170 180 190 200
QRSEGEKVRV GDDLILVSVA TERYLHTTKE NEQSIVNASF HVTHWSVQPY
210 220 230 240 250
GTGISRMKYV GYVFGGDVLR FFHGGDECLT IPSTWGREAG QNIVIYEGGV
260 270 280 290 300
VMAQARSLWR LELARTKWTG GFINWYHPMR IRHITTGRYL GVNDSNELIL
310 320 330 340 350
VKKEEASIAT TTFCLRQEKD DEKKVLEDKD LEVIGSPIIK YGDTTVIVQH
360 370 380 390 400
CETSLWLSYK SYETKKKGVG KVEEKQAILH EEGKMDDCLD FSRSQEEESK
410 420 430 440 450
TARVIRKCSS LFTQFITALE TLQSNRRHSI FFQKVNLNEM VMCLEDLINY
460 470 480 490 500
FSQPEDDMEH EEKQNRFRAL RNRQDLFQEE GVLNLILEAI DKINIITSQG
510 520 530 540 550
FLASFLAGDE TGQSWDLIST YLYQLLAAII KGNHTNCAQF ANSNRLNWLF
560 570 580 590 600
SRLGSQASSE GSGMLDVLHC VLIDSPEALN MMRDEHIKVI ISLLEKHGRD
610 620 630 640 650
PKVLDVLCSL CVGNGVAVRS SQNNICDFLL PGKNLLLQTL LVDHVASIRP
660 670 680 690 700
NIFVGRVDGS SMYQKWYFEV TMDHIEQTTH MMPHLRIGWA NTSGYVPYPG
710 720 730 740 750
GGKKWGGNGV GDDLYSFGFD GAFLWTGGRK TLVVDALPEE PFIRKGDVIG
760 770 780 790 800
VAIDLSVPII TFTFNGVKVR GSFRDFNLDG MFFPVMSCSS KLSCRFLFGG
810 820 830 840 850
DHGRLKFAPP MGFSALVQCL MPQQILSLDP CFYFGNLAKN VLAGPWLIED
860 870 880 890 900
DTAFVPKPVD TTGVTLPSSV DQIKEKLAEN IHEMWALNKI EAGWSWGEHR
910 920 930 940 950
DDYHRIHPCL THFEKLPAAE KRYDNQLAVQ TLKTIISLGY YITMDKPPAR
960 970 980 990 1000
IRPVRLPNEI FMQGNGYKPA PLDLSAVTLT PKLEELVDQL AENTHNLWAR
1010 1020 1030 1040 1050
ERIQQGWTYG LNEDSENHRS PHLVPYAKVD EAIKKANRDT ASETVRTLLV
1060 1070 1080 1090 1100
YGYVLDPPTG EGTEALLAEA QRLKFAGFRT YRVERNYAVT SGKWYFEFEV
1110 1120 1130 1140 1150
LTSGPMRVGW ARADCYPGAM LGSEDTSWAF DGHNVTKMHA GSIEHFGVRY
1160 1170 1180 1190 1200
EAGDVIGCFI DVKEQTISFS LNGELLMDAL GGETTFADVT AEGVGFVPAC
1210 1220 1230 1240 1250
TLGVGQKARL IYGQDVDSLK FFTTCGLQEG YEPFCVNMRR PVTHWYTKDQ
1260 1270 1280 1290 1300
PIFENTEEMP DCRIDVTRIP GGADTPPHLK ISHNTFETME KANWEFLRLS
1310 1320 1330 1340 1350
LPVTCMGEFI SEQEKARRWD EIKNRQYRLM REAEIAAQMQ VQTQAAHMDH
1360 1370 1380 1390 1400
MLKGGFNMND IKGLTRNFDE HADAEADHMM RGPNRPPRKG SLTRNITFET
1410 1420 1430 1440 1450
DMSAALDEMQ RSTSVLDMNG LGEEMDDKKK RGRSPFKFFS KKSRDQSREK
1460 1470 1480 1490 1500
MGARTLDTSL ERRNTVAHGR NVVNQQMTTR APTLRLNNAE IPPSPVPQGP
1510 1520 1530 1540 1550
KQLSGSNLGQ QPVETSGDEM FDAECLKLIN EYFYGVRIFP GQDPTHVYVG
1560 1570 1580 1590 1600
WVTTQYHLHS REFNKNKVRR GSVYIEDDYE MAIERIDRQS CYVVRADELF
1610 1620 1630 1640 1650
NEVTQDASGK GASQGMFVGC FVDTATGIIR FTCEGKDTSH RWMMEPDTKL
1660 1670 1680 1690 1700
FPAIFVEATS KEILQIELGR TPTTLPLSAA VLPTSDKHIN PQSPPRLKVQ
1710 1720 1730 1740 1750
CLRPHQWARV PNTALQVHAL KLSDVRGWSM LCEDPVSMLA LHIPEEDRCI
1760 1770 1780 1790 1800
DILELIEMDK LLSFHAHSLT LYAALCYQSN YRAAHALCQH VDQKQLLYAI
1810 1820 1830 1840 1850
RSEYMSGPLR QGFYDLLIAL HLESHATTME VCKNEYITPL GAELKELYSD
1860 1870 1880 1890 1900
EEMQHSLRSL VTESVRPQLR MTEITPPVIA TSSMPSVSSE PIPDIDQLYS
1910 1920 1930 1940 1950
PKFPLEVVRQ FVMEALKDAV EINQVHNRDP IGWTNENLFL PLIKLTDRLL
1960 1970 1980 1990 2000
LVGVLTDEDV QRLLVMIDPE TWDQAFEREG KDEHRKGLLT MKMAEGAKLQ
2010 2020 2030 2040 2050
MCYLLHHLYD TQLRHRVESI IAFSHDFVGD LQTDQLRRYI EIKQSDLPSA
2060 2070 2080 2090 2100
VAAKKTKEFR CPPREQMNQI LCFKNLEPDD QDNCTCGLEL RGRLGDFHDS
2110 2120 2130 2140 2150
LMQKVSLNAL QEPDGVEGTA IEEVKTGPIT KIYNFINTVK ELEEGPKEVE
2160 2170 2180 2190 2200
EPEKKTPEEV FRKVLIKTIV SWAEESQIEN PKLVREMFSL LLRQYDTVGE
2210 2220 2230 2240 2250
LVRALEKTYV INTRARDDVA EMWVGLSQIR ALLPVQMSQE EEELMRKRLW
2260 2270 2280 2290 2300
KLVNNATFFQ HPDLIRILRV HENVMAVMMN TLGRRAQAQS DAPTQSEVAE
2310 2320 2330 2340 2350
GAPSKEKDTS HEMVVACCRF LCYFCRTGRQ NQKAMFDHFD FLLDNANILL
2360 2370 2380 2390 2400
ARPSLRGSTP LDVAYSSLME NTELALALRE HYLEKIAVYL SRCGLQSNSE
2410 2420 2430 2440 2450
LVEKGYPDLG WDPVEGERYL DFLRYCVWVN GESVEENANL VIRLLIRRPE
2460 2470 2480 2490 2500
CLGPALRGEG EGLFRAIVEA NRMSERISDR CKMQDEAEGT IAGLNFTHPL
2510 2520 2530 2540 2550
PEGEEDEDYI DTGAAILNFY CTLVDLLGRC APDASVIEQG KNESLRARAI
2560 2570 2580 2590 2600
LRSLVPLEDL QGVLSLKFTL SQTAPGEEKP KSDMPSGLLP NNKQSIVLFL
2610 2620 2630 2640 2650
ERVYGIEAQD LFYRLLEDAF LPDLRTATIL DKSDGSESDM ALAMNRYIGN
2660 2670 2680 2690 2700
SILPLLIKHS KFYNEAENYA SLLDATLHTV YRLSKNRMLT KGQREAVSDF
2710 2720 2730 2740 2750
LVALTSQMQP AMLLKLLRKL TVDVSKLSEY TTVALRLLTL HFDRCAKYYG
2760 2770 2780 2790 2800
STQGQGSYGA SSDEEKRLTM LLFSNIFDSL SNMDYDPELF GKALPCLIAI
2810 2820 2830 2840 2850
GCALPPDYSL SKNTDEDYYG RQMGAPDQPQ YMPNPIDTNN VHLDNDLNSL
2860 2870 2880 2890 2900
VQKFSEHYHD AWASRRLEGG WTYGDIRSDN DRKHPRLKPY NMLSEYERER
2910 2920 2930 2940 2950
YRDPVRECLK GLLAIGWTVE HSEVEVALNH RGSTRRQSKP QINEFQNEGS
2960 2970 2980 2990 3000
PFNYNPHPVD MSNLTLSREM QNMAERLAEN SHDIWAKKKN EELNGCGGVI
3010 3020 3030 3040 3050
HPQLVPYDLL TDKEKKKDRE RSQEFLKYMQ YQGYKLHKPS KGGAVEEGGA
3060 3070 3080 3090 3100
TQAAVELRFS YSLLEKLIQY LDRATINMKL LKPSTTFSRR SSFKTATRDI
3110 3120 3130 3140 3150
KFFSKVVLPL MEKYFSTHRN YFIAIATATN NIGAASLKEK EMVASIFCKL
3160 3170 3180 3190 3200
AALLRNRLSA FGPDVRITVR CLQVLVKGID ARTLTKNCPE FIRTSMLTFF
3210 3220 3230 3240 3250
NQTSDDLGNT ILNLQDGKYS HLRGTHLKTS TSLGYVNQVV LPVLTAMFDH
3260 3270 3280 3290 3300
LAACDYGSDL LLDEIQVASY KILAALYHLG TDGTLTHDRK YLKTEIERHR
3310 3320 3330 3340 3350
PALGSCLGAY SSCFPVAFLE PHLNKHNQYS LLNRIADHSL EAQDIMVKME
3360 3370 3380 3390 3400
SCMPNLETIL AEVDQFVESD KTYNDAPHII DVILPLLCAY LPFWWSQGPD
3410 3420 3430 3440 3450
NVSPTSGNHV TMVTADHMNP LLRNVLKMIK KNIGNDNAPW MTRIAAYTQQ
3460 3470 3480 3490 3500
IIINTSEELL KDPFLPLAER VKKRTENMLH KEDSMRGFIK SATDDTSQVE
3510 3520 3530 3540 3550
TQLQEDWNLL VRDIYSFYPL LIKYVDLQRN HWLKDNIPEA EELYNHVAEI
3560 3570 3580 3590 3600
FNIWSKSQYF LKEEQNFISA NEIDNMALIM PTATRRSAIS EGAPAVGGKV
3610 3620 3630 3640 3650
KKKKKNRDKK RDKDKEVQAS LMVACLKRLL PVGLNLFAGR EQELVQHCKD
3660 3670 3680 3690 3700
RYLKKMPEYD VIEFARNQLT LPDKLDPSDE MSWQHYLYSK LGKTEEPVDE
3710 3720 3730 3740 3750
QALEKANVNS NEKGKDKTQE TVDRIVAMAK VLFGLHMIDH PQQQSKNVYR
3760 3770 3780 3790 3800
SVVSIQRKRA VIACFRQTSL HSLPRHRACN IFARSYYEQW LQEENVGQEV
3810 3820 3830 3840 3850
MVEDLTQTFE DSEKSKKEGE ETDSKPDPLT QLVTTFCRGA MTERSGALQE
3860 3870 3880 3890 3900
DLLYMSYAQI AAKSTGKEEE EGGDEEGGEG GEEGEGTSIH EQEMEKQKLL
3910 3920 3930 3940 3950
FHQARLSNRG VAEMVLLHIS ASKGIPSEMV MTTLNLGIAI LRGGNIDIQM
3960 3970 3980 3990 4000
GMLNHLKEKK DVGFFTSIAG LMNSCSVLDL DAFERNTKAE GLGVGSEGAA
4010 4020 4030 4040 4050
GEKNMHDAEF TCALFRFIQL TCEGHNLEWQ NYLRTQAGNT TTVNVVICTV
4060 4070 4080 4090 4100
DYLLRLQESI MDFYWHYSSK EIIDPAGKAN FFKAIEVASQ VFNTLTEVIQ
4110 4120 4130 4140 4150
GPCTLNQQAL AHSRLWDAVG GFLFLFSHMQ DKLSKHSSQV DLLKELLNLQ
4160 4170 4180 4190 4200
KDMITMMLSM LEGNVVNGTI GKQMVDTLVE SASNVELILK YFDMFLKLAD
4210 4220 4230 4240 4250
LIESPSFHEV DMKNEGWVTP KDFREKMEQS KNYTPEEMDF LLACCERNHE
4260 4270 4280 4290 4300
GKIDYRAFVE HFHEPSKEIG FNLAVLLTNL SEHMPNEPRL ARFLETAGSV
4310 4320 4330 4340 4350
LNYFEPFLGR IEILGSSKRI ERVYFEIKDS NIEQWEKPQI RESKRAFFYS
4360 4370 4380 4390 4400
IVTEGGDKEK LEAFVNFCED AIFEMTHASG LMATDDGGGN VKRDTAYSSY
4410 4420 4430 4440 4450
MSEEEEERAA RDPIRRTITA VKEGLKFGVH MLSPANIKHQ IGVMQTKSIP
4460 4470 4480 4490 4500
ELIVGFFKII FYIFYYTGYA HFCVVRYIFG ILLNLMRGPA PEQEEEPVVE
4510 4520 4530 4540 4550
EETFGRALPP LPLEEPPGTV QAFGLDINKE ENGMYKVVVH ESPANSSMEE
4560 4570 4580 4590 4600
GGESSPEDGA AASGELVEGE PHQEPISIVD LLGGEAAKKA AQERQEAQKA
4610 4620 4630 4640 4650
QEAAMASIEA EAKKSSSAPQ ETPAVHQIDF SQYTHRAVSF LARNFYNLKY
4660 4670 4680 4690 4700
VALVLAFSIN FMLLFYKVTS FTEEADSSAE EELILGSGSG GGADITGSGF
4710 4720 4730 4740 4750
GGSGDGGSGD GEMEDEIPEL VHVDEDFFYM EHVLRIAACL HSLVSLAMLI
4760 4770 4780 4790 4800
AYYHLKVPLA IFKREKEIAR RLEFEGLFIA EQPEDDDFKS HWDKLVISAK
4810 4820 4830 4840 4850
SFPVNYWDKF VKKKVRQKYS ETYDFDSISN LLGMEKSTFA AQESEETGIF
4860 4870 4880 4890 4900
KYIMNIDWRY QVWKAGVTFT DNAFLYSLWY FSFSVMGNFN NFFFAAHLLD
4910 4920 4930 4940 4950
VAVGFKTLRT ILQSVTHNGK QLVLTVMLLT IIVYIYTVIA FNFFRKFYIQ
4960 4970 4980 4990 5000
EEDEEVDKKC HDMLTCFVFH LYKGVRAGGG IGDEIGDPDG DDYEVYRIIF
5010 5020 5030 5040 5050
DITFFFFVII ILLAIIQGLI IDAFGELRDQ LESVKDNMES NCFICGMGKD
5060 5070 5080 5090 5100
FFDIVPHGFD THVQKEHNLA NYMFFLMHLI NKPDTEYTGQ ETYVWNMYQQ
5110 5120
RSWDFFPVGD CFRKQYEDEL SGGGGGG
Length:5,127
Mass (Da):581,012
Last modified:June 1, 2003 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i01B637D778DECE6A
GO
Isoform B1 Publication (identifier: Q24498-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1876-1889: Missing.

Show »
Length:5,113
Mass (Da):579,671
Checksum:iCFE36D40BE6729B5
GO
Isoform C1 Publication (identifier: Q24498-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1135-1165: VTKMHAGSIEHFGVRYEAGDVIGCFIDVKEQ → EEKVYGGVSESFGKQCGPGDIVGVFLDLADH

Show »
Length:5,127
Mass (Da):580,829
Checksum:iC4F4F3B75DCEC0AC
GO
Isoform D1 Publication (identifier: Q24498-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1135-1165: VTKMHAGSIEHFGVRYEAGDVIGCFIDVKEQ → EEKVYGGVSESFGKQCGPGDIVGVFLDLADH
     1876-1889: Missing.

Show »
Length:5,113
Mass (Da):579,487
Checksum:i6BE70740475694AB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0B4K715A0A0B4K715_DROME
Ryanodine receptor, isoform J
RyR D-RyR, Dmel\CG10844, DmRyR, DRR, DRY
5,115Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4K719A0A0B4K719_DROME
Ryanodine receptor, isoform I
RyR D-RyR, Dmel\CG10844, DmRyR, DRR, DRY
5,134Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4K7U9A0A0B4K7U9_DROME
Ryanodine receptor, isoform G
RyR D-RyR, Dmel\CG10844, DmRyR, DRR, DRY
5,123Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4K7K0A0A0B4K7K0_DROME
Ryanodine receptor, isoform F
RyR D-RyR, Dmel\CG10844, DmRyR, DRR, DRY
5,119Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4K837A0A0B4K837_DROME
Ryanodine receptor, isoform E
RyR D-RyR, Dmel\CG10844, DmRyR, DRR, DRY
5,117Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4K6T5A0A0B4K6T5_DROME
Ryanodine receptor, isoform H
RyR D-RyR, Dmel\CG10844, DmRyR, DRR, DRY
5,130Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti314 – 316CLR → SW in BAA41469 (PubMed:8276118).Curated3
Sequence conflicti314 – 316CLR → SW in BAA41470 (PubMed:8276118).Curated3
Sequence conflicti314 – 316CLR → SW in BAA41471 (PubMed:8276118).Curated3
Sequence conflicti314 – 316CLR → SW in BAA04212 (PubMed:8276118).Curated3
Sequence conflicti1045 – 1079VRTLL…FAGFR → SANAPGLRICLGSSDGRRNG GTSGRGTTPQVRRIP in BAA41469 (PubMed:8276118).CuratedAdd BLAST35
Sequence conflicti1045 – 1079VRTLL…FAGFR → SANAPGLRICLGSSDGRRNG GTSGRGTTPQVRRIP in BAA41470 (PubMed:8276118).CuratedAdd BLAST35
Sequence conflicti1045 – 1079VRTLL…FAGFR → SANAPGLRICLGSSDGRRNG GTSGRGTTPQVRRIP in BAA41471 (PubMed:8276118).CuratedAdd BLAST35
Sequence conflicti1045 – 1079VRTLL…FAGFR → SANAPGLRICLGSSDGRRNG GTSGRGTTPQVRRIP in BAA04212 (PubMed:8276118).CuratedAdd BLAST35
Sequence conflicti2282L → I in BAA41469 (PubMed:8276118).Curated1
Sequence conflicti2282L → I in BAA41470 (PubMed:8276118).Curated1
Sequence conflicti2282L → I in BAA41471 (PubMed:8276118).Curated1
Sequence conflicti2282L → I in BAA04212 (PubMed:8276118).Curated1
Sequence conflicti2550I → S in BAA41469 (PubMed:8276118).Curated1
Sequence conflicti2550I → S in BAA41470 (PubMed:8276118).Curated1
Sequence conflicti2550I → S in BAA41471 (PubMed:8276118).Curated1
Sequence conflicti2550I → S in BAA04212 (PubMed:8276118).Curated1
Sequence conflicti2927A → P in BAA41469 (PubMed:8276118).Curated1
Sequence conflicti2927A → P in BAA41470 (PubMed:8276118).Curated1
Sequence conflicti2927A → P in BAA41471 (PubMed:8276118).Curated1
Sequence conflicti2927A → P in BAA04212 (PubMed:8276118).Curated1
Sequence conflicti3214L → Q in BAA41469 (PubMed:8276118).Curated1
Sequence conflicti3214L → Q in BAA41470 (PubMed:8276118).Curated1
Sequence conflicti3214L → Q in BAA41471 (PubMed:8276118).Curated1
Sequence conflicti3214L → Q in BAA04212 (PubMed:8276118).Curated1
Sequence conflicti3361A → G in BAA41469 (PubMed:8276118).Curated1
Sequence conflicti3361A → G in BAA41470 (PubMed:8276118).Curated1
Sequence conflicti3361A → G in BAA41471 (PubMed:8276118).Curated1
Sequence conflicti3361A → G in BAA04212 (PubMed:8276118).Curated1
Sequence conflicti4096T → I in BAA41469 (PubMed:8276118).Curated1
Sequence conflicti4096T → I in BAA41470 (PubMed:8276118).Curated1
Sequence conflicti4096T → I in BAA41471 (PubMed:8276118).Curated1
Sequence conflicti4096T → I in BAA04212 (PubMed:8276118).Curated1
Sequence conflicti4633Y → D (PubMed:1338312).Curated1
Sequence conflicti4695I → T (PubMed:1338312).Curated1
Sequence conflicti5022 – 5024DAF → AL (PubMed:1338312).Curated3
Sequence conflicti5073M → I (PubMed:1338312).Curated1
Sequence conflicti5077M → L (PubMed:1338312).Curated1
Sequence conflicti5103 – 5127WDFFP…GGGGG → GTSSQWETASASNTRMSFPA EAAAA (PubMed:1338312).CuratedAdd BLAST25

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0501951135 – 1165VTKMH…DVKEQ → EEKVYGGVSESFGKQCGPGD IVGVFLDLADH in isoform C and isoform D. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_0501961876 – 1889Missing in isoform B and isoform D. 1 PublicationAdd BLAST14

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D17389 Genomic DNA Translation: BAA04212.1
D17389 Genomic DNA Translation: BAA41469.1
D17389 Genomic DNA Translation: BAA41470.1
D17389 Genomic DNA Translation: BAA41471.1
AE013599 Genomic DNA Translation: AAF59036.2
AE013599 Genomic DNA Translation: AAM71082.1
AE013599 Genomic DNA Translation: AAM71083.1
AE013599 Genomic DNA Translation: AAM71084.1
Z18536 mRNA Translation: CAA79221.1

Protein sequence database of the Protein Information Resource

More...
PIRi
B49131
S40450

NCBI Reference Sequences

More...
RefSeqi
NP_476991.1, NM_057643.4 [Q24498-2]
NP_476992.1, NM_057644.4 [Q24498-3]
NP_476993.1, NM_057645.3 [Q24498-4]
NP_476994.1, NM_057646.4 [Q24498-5]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0088637; FBpp0087718; FBgn0011286 [Q24498-4]
FBtr0088638; FBpp0087719; FBgn0011286 [Q24498-3]
FBtr0088639; FBpp0087720; FBgn0011286 [Q24498-5]
FBtr0088640; FBpp0087721; FBgn0011286 [Q24498-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
49090

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG10844

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D17389 Genomic DNA Translation: BAA04212.1
D17389 Genomic DNA Translation: BAA41469.1
D17389 Genomic DNA Translation: BAA41470.1
D17389 Genomic DNA Translation: BAA41471.1
AE013599 Genomic DNA Translation: AAF59036.2
AE013599 Genomic DNA Translation: AAM71082.1
AE013599 Genomic DNA Translation: AAM71083.1
AE013599 Genomic DNA Translation: AAM71084.1
Z18536 mRNA Translation: CAA79221.1
PIRiB49131
S40450
RefSeqiNP_476991.1, NM_057643.4 [Q24498-2]
NP_476992.1, NM_057644.4 [Q24498-3]
NP_476993.1, NM_057645.3 [Q24498-4]
NP_476994.1, NM_057646.4 [Q24498-5]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi71972, 9 interactors
IntActiQ24498, 13 interactors
STRINGi7227.FBpp0293114

Chemistry databases

BindingDBiQ24498
ChEMBLiCHEMBL6045

Protein family/group databases

TCDBi1.A.3.1.5, the ryanodine-inositol 1,4,5-triphosphate receptor ca(2+) channel (rir-cac) family

PTM databases

iPTMnetiQ24498

Proteomic databases

PaxDbiQ24498
PRIDEiQ24498

Genome annotation databases

EnsemblMetazoaiFBtr0088637; FBpp0087718; FBgn0011286 [Q24498-4]
FBtr0088638; FBpp0087719; FBgn0011286 [Q24498-3]
FBtr0088639; FBpp0087720; FBgn0011286 [Q24498-5]
FBtr0088640; FBpp0087721; FBgn0011286 [Q24498-2]
GeneIDi49090
KEGGidme:Dmel_CG10844

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
49090
FlyBaseiFBgn0011286, RyR

Phylogenomic databases

eggNOGiKOG2243, Eukaryota
GeneTreeiENSGT00940000168850
InParanoidiQ24498
PhylomeDBiQ24498

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
49090, 0 hits in 3 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
49090

Protein Ontology

More...
PROi
PR:Q24498

Gene expression databases

BgeeiFBgn0011286, Expressed in oviduct (Drosophila) and 32 other tissues
ExpressionAtlasiQ24498, baseline and differential
GenevisibleiQ24498, DM

Family and domain databases

CDDicd12877, SPRY1_RyR, 1 hit
cd12878, SPRY2_RyR, 1 hit
cd12879, SPRY3_RyR, 1 hit
Gene3Di2.60.120.920, 3 hits
InterProiView protein in InterPro
IPR001870, B30.2/SPRY
IPR043136, B30.2/SPRY_sf
IPR013320, ConA-like_dom_sf
IPR011992, EF-hand-dom_pair
IPR014821, Ins145_P3_rcpt
IPR005821, Ion_trans_dom
IPR036300, MIR_dom_sf
IPR016093, MIR_motif
IPR013662, RIH_assoc-dom
IPR000699, RIH_dom
IPR013333, Ryan_recept
IPR003032, Ryanodine_rcpt
IPR009460, Ryanrecept_TM4-6
IPR035910, RyR/IP3R_RIH_dom_sf
IPR035761, SPRY1_RyR
IPR035764, SPRY2_RyR
IPR035762, SPRY3_RyR
IPR003877, SPRY_dom
PfamiView protein in Pfam
PF08709, Ins145_P3_rec, 1 hit
PF00520, Ion_trans, 1 hit
PF02815, MIR, 1 hit
PF08454, RIH_assoc, 1 hit
PF06459, RR_TM4-6, 1 hit
PF01365, RYDR_ITPR, 2 hits
PF02026, RyR, 4 hits
PF00622, SPRY, 3 hits
PRINTSiPR00795, RYANODINER
SMARTiView protein in SMART
SM00472, MIR, 4 hits
SM00449, SPRY, 3 hits
SUPFAMiSSF100909, SSF100909, 1 hit
SSF47473, SSF47473, 1 hit
SSF49899, SSF49899, 2 hits
SSF82109, SSF82109, 2 hits
PROSITEiView protein in PROSITE
PS50188, B302_SPRY, 3 hits
PS50919, MIR, 5 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRYR_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q24498
Secondary accession number(s): Q24321
, Q24499, Q24500, Q24501, Q8MKS3, Q8MKS4, Q8MKS5, Q9V4Y7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2003
Last sequence update: June 1, 2003
Last modified: December 2, 2020
This is version 177 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again