Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 166 (02 Jun 2021)
Sequence version 2 (01 Oct 2001)
Previous versions | rss
Add a publicationFeedback
Protein

DNA-binding protein Ewg

Gene

ewg

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May function as a positive regulator of transcription in developing and differentiated neurons, regulating common aspects of neuronal differentiation and maintenance. Requirement in the CNS may be higher than in the peripheral system. Vital for development of the indirect flight muscles.

1 Publication1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi167 – 379By similarityAdd BLAST213

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding
Biological processTranscription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DNA-binding protein Ewg
Alternative name(s):
Protein erect wing
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ewg
ORF Names:CG3114
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0005427, ewg

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001002131 – 733DNA-binding protein EwgAdd BLAST733

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei97Phosphoserine; by CK2By similarity1
Modified residuei110Phosphoserine; by CK2By similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q24312

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform A is highly expressed in possibly all embryonic neurons and is enriched in adult heads. Other isoforms show similar expression at a much lower level. Transient expression in migrating myoblasts.2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed throughout development, beginning at embryonic stage 12 when levels steadily increase and then drop dramatically at third-instar larvae. Levels increase in 24 hour pupae and remain until adulthood.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0005427, Expressed in central nervous system and 47 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q24312, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q24312, DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Binds DNA as a dimer (By similarity).

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
57548, 66 interactors

Protein interaction database and analysis system

More...
IntActi
Q24312, 5 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0300529

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni13 – 51DisorderedSequence analysisAdd BLAST39
Regioni69 – 136DimerizationBy similarityAdd BLAST68
Regioni375 – 663Required for transcriptional activationBy similarityAdd BLAST289

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi146 – 174Nuclear localization signalBy similarityAdd BLAST29

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NRF1/Ewg family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QTK1, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000006835

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_018156_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q24312

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039142, NRF1/Ewg
IPR019526, Nrf1_activation-bd
IPR019525, Nrf1_NLS/DNA-bd_dimer

The PANTHER Classification System

More...
PANTHERi
PTHR20338, PTHR20338, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10492, Nrf1_activ_bdg, 1 hit
PF10491, Nrf1_DNA-bind, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 7 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform A (identifier: Q24312-1) [UniParc]FASTAAdd to basket
Also known as: C

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATTSYRLVV APAGSQRSST GNVVVTTTSS GSHSSNGANG GTGGTSAGSS
60 70 80 90 100
TLGSGLNVTT ITATSGGQLQ SAGNTSQSNG TTYKIEMLEE DIQSLGSDDD
110 120 130 140 150
DEDLISSDGS LYEGDLGSMP VNDDVAHQLA AAGPVGVAAA AAIASSKKRK
160 170 180 190 200
RPHCFETNPS VRKRQQNRLL RKLRAIIYEF TGRVGKQAVV LVATPGKPNT
210 220 230 240 250
SYKVFGAKPL EDVLRNLKNI VMDELDNALA QQAPPPPQDD PSLFELPGLV
260 270 280 290 300
IDGIPTPVEK MTQAQLRAFI PLMLKYSTGR GKPGWGREST RPPWWPKELP
310 320 330 340 350
WANVRMDARS EDDKQKISWT HALRKIVINC YKYHGREDLL PTFADDEDKV
360 370 380 390 400
NALISQSGDE DEDMELSNPP TIHTVTTMTP PTGNSNQPQQ VNVVKINSAG
410 420 430 440 450
TVITTHTAQS NTPAPTIIQS TNNQHVTTTA TLPASTKIEI CQAPAQNQQH
460 470 480 490 500
HQHHQTHLPN AVHIQPVAGG QPQTIQLTTA SGTATATAVQ TTAAAVSAAQ
510 520 530 540 550
AHAHSQSQAH SQSSANQTVT AQQIANAQVC IEPITLSDVD YTTQTVLSQN
560 570 580 590 600
ADGTVSLIQV DPNNPIITLP DGTTAQVQGV ATLHQGEGGA TIQTVQSLTD
610 620 630 640 650
VNGHENMTVD LTETQDGQIY ITTEDGQGYP VSVSNVISVP VSMYQSVMAN
660 670 680 690 700
VQQIQTNSDG TVCLAPMQVE NGDQLETITM SPGMHQMMIQ GGPGQEPQLV
710 720 730
QVVSLKDATL LSKAMEAINS GNVKSEDTII MEQ
Length:733
Mass (Da):77,763
Last modified:October 1, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA1CA6CD7AB3177A3
GO
Isoform B (identifier: Q24312-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     670-733: ENGDQLETIT...KSEDTIIMEQ → DTSINRSTST...LPAIKLEHLG

Show »
Length:840
Mass (Da):88,487
Checksum:i95AEE47C155AC795
GO
Isoform D (identifier: Q24312-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     541-581: YTTQTVLSQN...GTTAQVQGVA → LIVIELLVIS...SHRTPMVPYR
     582-733: Missing.

Show »
Length:581
Mass (Da):62,183
Checksum:i1B51DEAAA0E14E71
GO
Isoform E (identifier: Q24312-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     669-733: VENGDQLETI...KSEDTIIMEQ → IGKLENFRGPLDLWRMATSWRPSPCRLECTR

Show »
Length:699
Mass (Da):74,454
Checksum:iDD78AD23DD77624E
GO
Isoform F (identifier: Q24312-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-540: Missing.

Show »
Length:579
Mass (Da):61,836
Checksum:iD2297EA6D7510A01
GO
Isoform G (identifier: Q24312-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-540: Missing.
     669-733: VENGDQLETI...KSEDTIIMEQ → IGKLENFRGPLDLWRMATSWRPSPCRLECTR

Show »
Length:545
Mass (Da):58,526
Checksum:i253961D186BE408D
GO
Isoform H (identifier: Q24312-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-427: QPQQVNVVKI...IQSTNNQHVT → LIVIELLVIS...SHRTPMVPYR
     428-733: Missing.

Show »
Length:427
Mass (Da):46,255
Checksum:i9F862F6D0E674AAE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M9NEL5M9NEL5_DROME
Erect wing, isoform K
ewg Dmel\CG3114, EC3, EG:BACR37P7.7, EWG, Ewg
843Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9NE19M9NE19_DROME
Erect wing, isoform J
ewg Dmel\CG3114, EC3, EG:BACR37P7.7, EWG, Ewg
689Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PG44M9PG44_DROME
Erect wing, isoform L
ewg Dmel\CG3114, EC3, EG:BACR37P7.7, EWG, Ewg
828Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PGI0M9PGI0_DROME
Erect wing, isoform M
ewg Dmel\CG3114, EC3, EG:BACR37P7.7, EWG, Ewg
795Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PGB3M9PGB3_DROME
Erect wing, isoform N
ewg Dmel\CG3114, EC3, EG:BACR37P7.7, EWG, Ewg
343Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAL90347 differs from that shown. Unusual initiator. The initiator methionine is coded by a non-canonical CTG leucine codon.Curated
The sequence CAB43325 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti172 – 173KL → NV in AAA28478 (PubMed:8388540).Curated2
Sequence conflicti172 – 173KL → NV in AAD34460 (PubMed:10330140).Curated2
Isoform B (identifier: Q24312-4)
Sequence conflicti777V → A in AAL90347 (PubMed:12537569).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_026515387 – 540Missing in isoform F and isoform G. CuratedAdd BLAST154
Alternative sequenceiVSP_026516387 – 427QPQQV…NQHVT → LIVIELLVISIIICIRHKLK KHTHITPRKRSSHRTPMVPY R in isoform H. CuratedAdd BLAST41
Alternative sequenceiVSP_026517428 – 733Missing in isoform H. CuratedAdd BLAST306
Alternative sequenceiVSP_026518541 – 581YTTQT…VQGVA → LIVIELLVISIIICIRHKLK KHTHITPRKRSSHRTPMVPY R in isoform D. CuratedAdd BLAST41
Alternative sequenceiVSP_026519582 – 733Missing in isoform D. CuratedAdd BLAST152
Alternative sequenceiVSP_026520669 – 733VENGD…IIMEQ → IGKLENFRGPLDLWRMATSW RPSPCRLECTR in isoform E and isoform G. CuratedAdd BLAST65
Alternative sequenceiVSP_003603670 – 733ENGDQ…IIMEQ → DTSINRSTSTAASSSSSLGN GGVQCYSLISAGSSVLSRRS GGVIGHQVTPGERYYLATTT SSSLGLNNNNNCTLANNNNS VKMPIVLATPSIPQVANKRS TGKRSTGVSGGDDVMVQKRG RPNSSSRSKSQLNANENAHS SGTSSSIRCVDSASLTNVQL QLPAIKLEHLG in isoform B. 1 PublicationAdd BLAST64

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L11345 mRNA Translation: AAA28478.1
AF135590 Genomic DNA Translation: AAD34460.1
AE014298 Genomic DNA Translation: AAF45491.5
AE014298 Genomic DNA Translation: AAF45492.5
AE014298 Genomic DNA Translation: AAX52466.1
AE014298 Genomic DNA Translation: AAX52467.1
AE014298 Genomic DNA Translation: AAX52468.1
AE014298 Genomic DNA Translation: AAX52469.1
AE014298 Genomic DNA Translation: AAX52470.1
AE014298 Genomic DNA Translation: AAX52471.1
AL050231 Genomic DNA Translation: CAB43325.1 Sequence problems.
AY089609 mRNA Translation: AAL90347.1 Sequence problems.

Protein sequence database of the Protein Information Resource

More...
PIRi
A48128

NCBI Reference Sequences

More...
RefSeqi
NP_001014707.1, NM_001014707.2 [Q24312-8]
NP_001014708.1, NM_001014708.2 [Q24312-7]
NP_001014709.1, NM_001014709.2 [Q24312-6]
NP_001014710.1, NM_001014710.2 [Q24312-5]
NP_001014711.1, NM_001014711.2 [Q24312-1]
NP_001014712.1, NM_001014712.2 [Q24312-9]
NP_476892.4, NM_057544.4 [Q24312-4]
NP_726660.3, NM_166836.2 [Q24312-1]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0089441; FBpp0088456; FBgn0005427 [Q24312-4]
FBtr0089442; FBpp0088457; FBgn0005427 [Q24312-1]
FBtr0100577; FBpp0100032; FBgn0005427 [Q24312-1]
FBtr0100578; FBpp0100033; FBgn0005427 [Q24312-5]
FBtr0100579; FBpp0100034; FBgn0005427 [Q24312-6]
FBtr0100580; FBpp0100035; FBgn0005427 [Q24312-7]
FBtr0100581; FBpp0100036; FBgn0005427 [Q24312-8]
FBtr0100582; FBpp0100037; FBgn0005427 [Q24312-9]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
30975

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG3114

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L11345 mRNA Translation: AAA28478.1
AF135590 Genomic DNA Translation: AAD34460.1
AE014298 Genomic DNA Translation: AAF45491.5
AE014298 Genomic DNA Translation: AAF45492.5
AE014298 Genomic DNA Translation: AAX52466.1
AE014298 Genomic DNA Translation: AAX52467.1
AE014298 Genomic DNA Translation: AAX52468.1
AE014298 Genomic DNA Translation: AAX52469.1
AE014298 Genomic DNA Translation: AAX52470.1
AE014298 Genomic DNA Translation: AAX52471.1
AL050231 Genomic DNA Translation: CAB43325.1 Sequence problems.
AY089609 mRNA Translation: AAL90347.1 Sequence problems.
PIRiA48128
RefSeqiNP_001014707.1, NM_001014707.2 [Q24312-8]
NP_001014708.1, NM_001014708.2 [Q24312-7]
NP_001014709.1, NM_001014709.2 [Q24312-6]
NP_001014710.1, NM_001014710.2 [Q24312-5]
NP_001014711.1, NM_001014711.2 [Q24312-1]
NP_001014712.1, NM_001014712.2 [Q24312-9]
NP_476892.4, NM_057544.4 [Q24312-4]
NP_726660.3, NM_166836.2 [Q24312-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi57548, 66 interactors
IntActiQ24312, 5 interactors
STRINGi7227.FBpp0300529

Proteomic databases

PaxDbiQ24312

Genome annotation databases

EnsemblMetazoaiFBtr0089441; FBpp0088456; FBgn0005427 [Q24312-4]
FBtr0089442; FBpp0088457; FBgn0005427 [Q24312-1]
FBtr0100577; FBpp0100032; FBgn0005427 [Q24312-1]
FBtr0100578; FBpp0100033; FBgn0005427 [Q24312-5]
FBtr0100579; FBpp0100034; FBgn0005427 [Q24312-6]
FBtr0100580; FBpp0100035; FBgn0005427 [Q24312-7]
FBtr0100581; FBpp0100036; FBgn0005427 [Q24312-8]
FBtr0100582; FBpp0100037; FBgn0005427 [Q24312-9]
GeneIDi30975
KEGGidme:Dmel_CG3114

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
30975
FlyBaseiFBgn0005427, ewg

Phylogenomic databases

eggNOGiENOG502QTK1, Eukaryota
GeneTreeiENSGT00390000006835
HOGENOMiCLU_018156_2_0_1
InParanoidiQ24312

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
30975, 0 hits in 1 CRISPR screen

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ewg, fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
30975

Protein Ontology

More...
PROi
PR:Q24312

Gene expression databases

BgeeiFBgn0005427, Expressed in central nervous system and 47 other tissues
ExpressionAtlasiQ24312, baseline and differential
GenevisibleiQ24312, DM

Family and domain databases

InterProiView protein in InterPro
IPR039142, NRF1/Ewg
IPR019526, Nrf1_activation-bd
IPR019525, Nrf1_NLS/DNA-bd_dimer
PANTHERiPTHR20338, PTHR20338, 1 hit
PfamiView protein in Pfam
PF10492, Nrf1_activ_bdg, 1 hit
PF10491, Nrf1_DNA-bind, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiEWG_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q24312
Secondary accession number(s): A4V3R8
, Q59E73, Q59E74, Q59E75, Q59E76, Q59E77, Q8SXJ1, Q9NF76, Q9W5G8, Q9W5G9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 15, 2002
Last sequence update: October 1, 2001
Last modified: June 2, 2021
This is version 166 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again