Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 179 (07 Apr 2021)
Sequence version 2 (20 Jun 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Voltage-dependent calcium channel type D subunit alpha-1

Gene

Ca-alpha1D

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. Encodes a dihydropyridine- and diltiazem-sensitive current in larval body wall muscle. Vital for embryonic development.1 Publication

Caution

It is uncertain whether Met-1, Met-494, Met-539, Met-544 or Met-553 is the initiator.Curated

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei836Calcium ion selectivity and permeabilityBy similarity1
Sitei1168Calcium ion selectivity and permeabilityBy similarity1
Sitei1559Calcium ion selectivity and permeabilityBy similarity1
Sitei1869Calcium ion selectivity and permeabilityBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi1957 – 1968By similarityAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalcium channel, Ion channel, Voltage-gated channel
Biological processCalcium transport, Ion transport, Transport
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-422356, Regulation of insulin secretion
R-DME-5576892, Phase 0 - rapid depolarisation
R-DME-5576893, Phase 2 - plateau phase

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Voltage-dependent calcium channel type D subunit alpha-1
Short name:
DmCa1D
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ca-alpha1D
Synonyms:DroCa1, l(2)35Fa
ORF Names:CG4894
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2L

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0001991, Ca-alpha1D

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 615CytoplasmicSequence analysisAdd BLAST615
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei616 – 634Helical; Name=S1 of repeat ISequence analysisAdd BLAST19
Topological domaini635 – 653ExtracellularSequence analysisAdd BLAST19
Transmembranei654 – 671Helical; Name=S2 of repeat ISequence analysisAdd BLAST18
Topological domaini672 – 684CytoplasmicSequence analysisAdd BLAST13
Transmembranei685 – 699Helical; Name=S3 of repeat ISequence analysisAdd BLAST15
Topological domaini700 – 711ExtracellularSequence analysisAdd BLAST12
Transmembranei712 – 730Helical; Name=S4 of repeat ISequence analysisAdd BLAST19
Topological domaini731 – 750CytoplasmicSequence analysisAdd BLAST20
Transmembranei751 – 770Helical; Name=S5 of repeat ISequence analysisAdd BLAST20
Topological domaini771 – 853ExtracellularSequence analysisAdd BLAST83
Transmembranei854 – 878Helical; Name=S6 of repeat ISequence analysisAdd BLAST25
Topological domaini879 – 985CytoplasmicSequence analysisAdd BLAST107
Transmembranei986 – 1005Helical; Name=S1 of repeat IISequence analysisAdd BLAST20
Topological domaini1006 – 1018ExtracellularSequence analysisAdd BLAST13
Transmembranei1019 – 1038Helical; Name=S2 of repeat IISequence analysisAdd BLAST20
Topological domaini1039 – 1047CytoplasmicSequence analysis9
Transmembranei1048 – 1066Helical; Name=S3 of repeat IISequence analysisAdd BLAST19
Topological domaini1067 – 1076ExtracellularSequence analysis10
Transmembranei1077 – 1095Helical; Name=S4 of repeat IISequence analysisAdd BLAST19
Topological domaini1096 – 1114CytoplasmicSequence analysisAdd BLAST19
Transmembranei1115 – 1134Helical; Name=S5 of repeat IISequence analysisAdd BLAST20
Topological domaini1135 – 1190ExtracellularSequence analysisAdd BLAST56
Transmembranei1191 – 1215Helical; Name=S6 of repeat IISequence analysisAdd BLAST25
Topological domaini1216 – 1339CytoplasmicSequence analysisAdd BLAST124
Transmembranei1340 – 1363Helical; Name=S1 of repeat IIISequence analysisAdd BLAST24
Topological domaini1364 – 1380ExtracellularSequence analysisAdd BLAST17
Transmembranei1381 – 1400Helical; Name=S2 of repeat IIISequence analysisAdd BLAST20
Topological domaini1401 – 1408CytoplasmicSequence analysis8
Transmembranei1409 – 1431Helical; Name=S3 of repeat IIISequence analysisAdd BLAST23
Topological domaini1432 – 1439ExtracellularSequence analysis8
Transmembranei1440 – 1454Helical; Name=S4 of repeat IIISequence analysisAdd BLAST15
Topological domaini1455 – 1475CytoplasmicSequence analysisAdd BLAST21
Transmembranei1476 – 1495Helical; Name=S5 of repeat IIISequence analysisAdd BLAST20
Topological domaini1496 – 1584ExtracellularSequence analysisAdd BLAST89
Transmembranei1585 – 1609Helical; Name=S6 of repeat IIISequence analysisAdd BLAST25
Topological domaini1610 – 1664CytoplasmicSequence analysisAdd BLAST55
Transmembranei1665 – 1683Helical; Name=S1 of repeat IVSequence analysisAdd BLAST19
Topological domaini1684 – 1697ExtracellularSequence analysisAdd BLAST14
Transmembranei1698 – 1717Helical; Name=S2 of repeat IVSequence analysisAdd BLAST20
Topological domaini1718 – 1726CytoplasmicSequence analysis9
Transmembranei1727 – 1745Helical; Name=S3 of repeat IVSequence analysisAdd BLAST19
Topological domaini1746 – 1777ExtracellularSequence analysisAdd BLAST32
Transmembranei1778 – 1796Helical; Name=S4 of repeat IVSequence analysisAdd BLAST19
Topological domaini1797 – 1815CytoplasmicSequence analysisAdd BLAST19
Transmembranei1816 – 1835Helical; Name=S5 of repeat IVSequence analysisAdd BLAST20
Topological domaini1836 – 1902ExtracellularSequence analysisAdd BLAST67
Transmembranei1903 – 1921Helical; Name=S6 of repeat IVSequence analysisAdd BLAST19
Topological domaini1922 – 2516CytoplasmicSequence analysisAdd BLAST595

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi629C → Y in AR66; slower channel activation and reduction of peak current. 2 Publications1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000539601 – 2516Voltage-dependent calcium channel type D subunit alpha-1Add BLAST2516

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi644N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi647N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q24270

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the adult body, head and leg. Highly expressed in the embryonic nervous system.

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Faintly expressed in embryos at 9-12 hours. Expression increases rapidly as the nervous system matures, peaking just prior to hatching. A second peak is observed in late pupal stages around 73-108 hours postpuparium.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0001991, Expressed in oviduct (Drosophila) and 26 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q24270, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q24270, DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
60962, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q24270, 7 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0089047

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati602 – 883IAdd BLAST282
Repeati971 – 1217IIAdd BLAST247
Repeati1331 – 1613IIIAdd BLAST283
Repeati1648 – 1929IVAdd BLAST282

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1533 – 1622Dihydropyridine bindingBy similarityAdd BLAST90
Regioni1885 – 1948Dihydropyridine bindingBy similarityAdd BLAST64
Regioni1896 – 1937Phenylalkylamine bindingBy similarityAdd BLAST42

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi59 – 62Poly-Val4
Compositional biasi208 – 211Poly-Gly4
Compositional biasi262 – 267Poly-Ser6
Compositional biasi322 – 328Poly-Ala7
Compositional biasi460 – 463Poly-Glu4
Compositional biasi1115 – 1121Poly-Leu7
Compositional biasi1288 – 1292Poly-Glu5
Compositional biasi1591 – 1597Poly-Ile7
Compositional biasi2466 – 2469Poly-Asn4

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2301, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000169312

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q24270

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q24270

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.120.350, 4 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR031649, GPHH_dom
IPR005821, Ion_trans_dom
IPR014873, VDCC_a1su_IQ
IPR005446, VDCC_L_a1su
IPR002077, VDCCAlpha1
IPR027359, Volt_channel_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08763, Ca_chan_IQ, 1 hit
PF16905, GPHH, 1 hit
PF00520, Ion_trans, 4 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00167, CACHANNEL
PR01630, LVDCCALPHA1

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01062, Ca_chan_IQ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform A (identifier: Q24270-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGGGELVNCI AYDDNTLVIE RKPSPSSPST SRRYLKAETP TRGSRKYNRK
60 70 80 90 100
SSAKSDLEVV VVKPEHHHQH RSPTITLPVP ANPLTTSASA GSSPTGAGLA
110 120 130 140 150
AGLGTASGTV LQQSCSALDP PEDSNQPSGT RRRPTSTELA LSNVTSQIVN
160 170 180 190 200
NATYKLDFKQ RRHKSNNGGS ESGSLTGIAT GPATSPAGPT GPTSSSGKRR
210 220 230 240 250
KSSCTSCGGG GISAPPPRLT PEEAWQLQPQ NSVTSAGSTN SSFSSGGGRD
260 270 280 290 300
DNSSYSAVGG DSSSSNSCNC DITGDNSTLH GFGVGDVCSF IADCDDNSED
310 320 330 340 350
DDGDPNNQDL SSQTLRTAAI VAAVAAAAKE QAQEQSLADC ESFSDRRQDA
360 370 380 390 400
DEDVRIIQDC CGGNNDSLED VGEVDDNADV VVRKNSRNRP SIRRTCRITE
410 420 430 440 450
EDDDEDENAD YGDFDREDQE LDDEEPEGTT IDIDEQEQQH DQGDSAEEED
460 470 480 490 500
DDEDVDEYFE EEEDDTQAFS PFYSSSAELI DNFGGGAGKF FNIMDFERGA
510 520 530 540 550
SGEGGFSPNG NGGPGSGDVS RTARYDSGEG DLGGGNNIMG IDSMGIANIP
560 570 580 590 600
ETMNGTTIGP SGAGGQKGGA AAGAAGQKRQ QRRGKPQPDR PQRALFCLSV
610 620 630 640 650
KNPLRALCIR IVEWKPFEFL ILLTIFANCI ALAVYTPYPG SDSNVTNQTL
660 670 680 690 700
EKVEYVFLVI FTAECVMKIL AYGFVLHNGA YLRNGWNLLD FTIVVIGAIS
710 720 730 740 750
TALSQLMKDA FDVKALRAFR VLRPLRLVSG VPSLQVVLNS ILKAMVPLFH
760 770 780 790 800
IALLVLFVII IYAIIGLELF SGKLHKACRD EITGEYEENI RPCGVGYQCP
810 820 830 840 850
PGYKCYGGWD GPNDGITNFD NFGLAMLTVF QCVTLEGWTD VLYSIQDAMG
860 870 880 890 900
SDWQWMYFIS MVILGAFFVM NLILGVLSGE FSKERNKAKN RGDFQKLREK
910 920 930 940 950
QQIEEDLRGY LDWITQAEDI EPDAVGGLIS DGKGKQPNEM DSTENLGEEM
960 970 980 990 1000
PEVQMTESRW RKMKKDFDRV NRRMRRACRK AVKSQAFYWL IIVLVFLNTG
1010 1020 1030 1040 1050
VLATEHYGQL DWLDNFQEYT NVFFIGLFTC EMLLKMYSLG FQGYFVSLFN
1060 1070 1080 1090 1100
RFDCFVVIGS ITETLLTNTG MMPPLGVSVL RCVRLLRVFK VTKYWRSLSN
1110 1120 1130 1140 1150
LVASLLNSIQ SIASLLLLLF LFIVIFALLG MQVFGGKFNF DGKEEKYRMN
1160 1170 1180 1190 1200
FDCFWQALLT VFQIMTGEDW NAVMYVGINA YGGVSSYGAL ACIYFIILFI
1210 1220 1230 1240 1250
CGNYILLNVF LAIAVDNLAD ADSLSEVEKE EEPHDESAQK KSHSPTPTID
1260 1270 1280 1290 1300
GMDDHLSIDI DMEQQELDDE DKMDHETLSD EEVREMCEEE EEVDEEGMIT
1310 1320 1330 1340 1350
ARPRRMSEVN TATKILPIPP GTSFFLFSQT NRFRVFCHWL CNHSNFGNII
1360 1370 1380 1390 1400
LCCIMFSSAM LAAENPLRAN DDLNKVLNKF DYFFTAVFTI ELILKLISYG
1410 1420 1430 1440 1450
FVLHDGAFCR SAFNLLDLLV VCVSLISLVS SSNAISVVKI LRVLRVLRPL
1460 1470 1480 1490 1500
RAINRAKGLK HVVQCVIVAV KTIGNIVLVT CLLQFMFAVI GVQLFKGKFF
1510 1520 1530 1540 1550
KCTDGSKMTQ DECYGTYLVY DDGDVHKPRL REREWSNNRF HFDDVAKGML
1560 1570 1580 1590 1600
TLFTVSTFEG WPGLLYVSID SNKENGGPIH NFRPIVAAYY IIYIIIIAFF
1610 1620 1630 1640 1650
MVNIFVGFVI VTFQNEGEQE YKNCDLDKNQ RNCIEFALKA KPVRRYIPKH
1660 1670 1680 1690 1700
GIQYKVWWFV TSSSFEYTIF ILIMINTVTL AMKFYNQPLW YTELLDALNM
1710 1720 1730 1740 1750
IFTAVFALEF VFKLAAFRFK NYFGDAWNVF DFIIVLGSFI DIVYSEIKSK
1760 1770 1780 1790 1800
DTSQIAECDI VEGCKSTKKS AGSNLISINF FRLFRVMRLV KLLSKGEGIR
1810 1820 1830 1840 1850
TLLWTFIKSF QALPYVALLI VLLFFIYAVV GMQVFGKIAL DGGNAITANN
1860 1870 1880 1890 1900
NFQTFQQAVL VLFRSATGEA WQEIMMSCSA QPDVKCDMNS DTPGEPCGSS
1910 1920 1930 1940 1950
IAYPYFISFY VLCSFLIINL FVAVIMDNFD YLTRDWSILG PHHLDEFIRL
1960 1970 1980 1990 2000
WSEYDPDAKG RIKHLDVVTL LRKISPPLGF GKLCPHRMAC KRLVSMNMPL
2010 2020 2030 2040 2050
NSDGTVLFNA TLFAVVRTSL SIKTDGNIDD ANSELRATIK QIWKRTNPKL
2060 2070 2080 2090 2100
LDQVVPPPGN DDEVTVGKFY ATYLIQDYFR RFKKRKEQEG KEGHPDSNTV
2110 2120 2130 2140 2150
TLQAGLRTLH EVSPALKRAI SGNLDELDQE PEPMHRRHHT LFGSVWSSIR
2160 2170 2180 2190 2200
RHGNGTFRRS AKATASQSNG ALAIGGSASA ALGVGGSSLV LGSSDPAGGD
2210 2220 2230 2240 2250
YLYDTLNRSV ADGVNNITRN IMQARLAAAG KLQDELQGAG SGGELRTFGE
2260 2270 2280 2290 2300
SISMRPLAKN GGGAATVAGT LPPEANAINY DNRNRGILLH PYNNVYAPNG
2310 2320 2330 2340 2350
ALPGHERMIQ STPASPYDQR RLPTSSDMNG LAESLIGGVL AAEGLGKYCD
2360 2370 2380 2390 2400
SEFVGTAARE MREALDMTPE EMNLAAHQIL SNEHSLSLIG SSNGSIFGGS
2410 2420 2430 2440 2450
AGGLGGAGSG GVGGLGGSSS IRNAFGGSGS GPSSLSPQHQ PYSGTLNSPP
2460 2470 2480 2490 2500
IPDNRLRRVA TVTTTNNNNK SQVSQNNSNS LNVRANANSQ MNMSPTGQPV
2510
QQQSPLRGQG NQTYSS
Length:2,516
Mass (Da):276,700
Last modified:June 20, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8CFC07499E750901
GO
Isoform B (identifier: Q24270-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1293-1329: VDEEGMITAR...PGTSFFLFSQ → DSNSEVSARV...RGSAFFIFSY

Show »
Length:2,519
Mass (Da):277,108
Checksum:iCA1E9A0374D8E955
GO
Isoform C (identifier: Q24270-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1496-1496: K → KYVVKCVVVAIKTIGNIMLVTYLLQFMFAVIGVQLFK

Show »
Length:2,552
Mass (Da):280,745
Checksum:i6C623BE5BE1B38E5
GO
Isoform D (identifier: Q24270-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2282-2300: NRNRGILLHPYNNVYAPNG → LRTQWCSSWPRTHDPIDTS
     2301-2516: Missing.

Show »
Length:2,300
Mass (Da):254,650
Checksum:i7F3C7A054B90EF1A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M9PBC0M9PBC0_DROME
Voltage-dependent L-type calcium ch...
Ca-alpha1D A1D, alpha1, alpha1D, BG:DS02795.1, Ca-_1D
2,023Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PD78M9PD78_DROME
Voltage-dependent L-type calcium ch...
Ca-alpha1D A1D, alpha1, alpha1D, BG:DS02795.1, Ca-_1D
2,023Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PDI5M9PDI5_DROME
Voltage-dependent L-type calcium ch...
Ca-alpha1D A1D, alpha1, alpha1D, BG:DS02795.1, Ca-_1D
2,059Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PFZ4M9PFZ4_DROME
Voltage-dependent L-type calcium ch...
Ca-alpha1D A1D, alpha1, alpha1D, BG:DS02795.1, Ca-_1D
1,799Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PD04M9PD04_DROME
Voltage-dependent L-type calcium ch...
Ca-alpha1D A1D, alpha1, alpha1D, BG:DS02795.1, Ca-_1D
2,026Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M9PDI1M9PDI1_DROME
Voltage-dependent L-type calcium ch...
Ca-alpha1D A1D, alpha1, alpha1D, BG:DS02795.1, Ca-_1D
2,699Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAL13497 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti134P → A in AAA81883 (PubMed:7869089).Curated1
Sequence conflicti282F → L in AAA81883 (PubMed:7869089).Curated1
Sequence conflicti678N → D in AAA81883 (PubMed:7869089).Curated1
Sequence conflicti683R → G in AAA81883 (PubMed:7869089).Curated1
Sequence conflicti696I → M in AAA81883 (PubMed:7869089).Curated1
Sequence conflicti1390I → M in AAA81883 (PubMed:7869089).Curated1
Sequence conflicti1433N → D in AAA81883 (PubMed:7869089).Curated1
Sequence conflicti2479N → S in AAA81883 (PubMed:7869089).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0175681293 – 1329VDEEG…FLFSQ → DSNSEVSARVTARPRRLSEV SMKKTKKPIPRGSAFFIFSY in isoform B. CuratedAdd BLAST37
Alternative sequenceiVSP_0175691496K → KYVVKCVVVAIKTIGNIMLV TYLLQFMFAVIGVQLFK in isoform C. Curated1
Alternative sequenceiVSP_0076042282 – 2300NRNRG…YAPNG → LRTQWCSSWPRTHDPIDTS in isoform D. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_0076052301 – 2516Missing in isoform D. 1 PublicationAdd BLAST216

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U00690 mRNA Translation: AAA81883.1
AE014134 Genomic DNA Translation: AAF53504.1
AE014134 Genomic DNA Translation: AAN10929.1
AE014134 Genomic DNA Translation: AAN10930.1
AE014134 Genomic DNA Translation: AAN10931.1
AY058268 mRNA Translation: AAL13497.1 Different initiation.

NCBI Reference Sequences

More...
RefSeqi
NP_525104.2, NM_080365.3
NP_602305.1, NM_134429.3
NP_723952.1, NM_165146.2
NP_723953.1, NM_165147.2

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0090003; FBpp0089046; FBgn0001991 [Q24270-2]
FBtr0090004; FBpp0089047; FBgn0001991 [Q24270-4]
FBtr0090005; FBpp0089048; FBgn0001991 [Q24270-3]
FBtr0090006; FBpp0089049; FBgn0001991 [Q24270-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
34950

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG4894

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U00690 mRNA Translation: AAA81883.1
AE014134 Genomic DNA Translation: AAF53504.1
AE014134 Genomic DNA Translation: AAN10929.1
AE014134 Genomic DNA Translation: AAN10930.1
AE014134 Genomic DNA Translation: AAN10931.1
AY058268 mRNA Translation: AAL13497.1 Different initiation.
RefSeqiNP_525104.2, NM_080365.3
NP_602305.1, NM_134429.3
NP_723952.1, NM_165146.2
NP_723953.1, NM_165147.2

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi60962, 3 interactors
IntActiQ24270, 7 interactors
STRINGi7227.FBpp0089047

Proteomic databases

PaxDbiQ24270

Genome annotation databases

EnsemblMetazoaiFBtr0090003; FBpp0089046; FBgn0001991 [Q24270-2]
FBtr0090004; FBpp0089047; FBgn0001991 [Q24270-4]
FBtr0090005; FBpp0089048; FBgn0001991 [Q24270-3]
FBtr0090006; FBpp0089049; FBgn0001991 [Q24270-1]
GeneIDi34950
KEGGidme:Dmel_CG4894

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
34950
FlyBaseiFBgn0001991, Ca-alpha1D

Phylogenomic databases

eggNOGiKOG2301, Eukaryota
GeneTreeiENSGT00940000169312
InParanoidiQ24270
PhylomeDBiQ24270

Enzyme and pathway databases

ReactomeiR-DME-422356, Regulation of insulin secretion
R-DME-5576892, Phase 0 - rapid depolarisation
R-DME-5576893, Phase 2 - plateau phase

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
34950, 0 hits in 3 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ca-alpha1D, fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
34950

Protein Ontology

More...
PROi
PR:Q24270

Gene expression databases

BgeeiFBgn0001991, Expressed in oviduct (Drosophila) and 26 other tissues
ExpressionAtlasiQ24270, baseline and differential
GenevisibleiQ24270, DM

Family and domain databases

Gene3Di1.20.120.350, 4 hits
InterProiView protein in InterPro
IPR031649, GPHH_dom
IPR005821, Ion_trans_dom
IPR014873, VDCC_a1su_IQ
IPR005446, VDCC_L_a1su
IPR002077, VDCCAlpha1
IPR027359, Volt_channel_dom_sf
PfamiView protein in Pfam
PF08763, Ca_chan_IQ, 1 hit
PF16905, GPHH, 1 hit
PF00520, Ion_trans, 4 hits
PRINTSiPR00167, CACHANNEL
PR01630, LVDCCALPHA1
SMARTiView protein in SMART
SM01062, Ca_chan_IQ, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCAC1D_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q24270
Secondary accession number(s): Q8IP23
, Q8IP24, Q8IP25, Q95U73, Q9V3P7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: June 20, 2003
Last modified: April 7, 2021
This is version 179 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again