Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q24246 (DYIN_DROME)

Entry version 206 (25 May 2022)
Sequence version 3 (03 Jul 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Cytoplasmic dynein 1 intermediate chain

Gene

sw

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the help dynein bind to dynactin 150 kDa component (By similarity).

By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMotor protein
Biological processTransport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-DME-3371497, HSP90 chaperone cycle for steroid hormone receptors (SHR) in the presence of ligand
R-DME-6807878, COPI-mediated anterograde transport
R-DME-6811436, COPI-independent Golgi-to-ER retrograde traffic
R-DME-9646399, Aggrephagy

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q24246

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cytoplasmic dynein 1 intermediate chain
Short name:
DH IC
Alternative name(s):
Dynein intermediate chain, cytosolic
Protein short wing
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:sw
Synonyms:Cdic, Dic19B
ORF Names:CG18000
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora ›
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Drosophila genome database

More...FlyBasei		FBgn0003654, sw

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		VectorBase:FBgn0003654

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Dynein, Lysosome, Membrane, Microtubule, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001146611 – 663Cytoplasmic dynein 1 intermediate chainAdd BLAST663

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q24246

PRoteomics IDEntifications database

More...PRIDEi		Q24246

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

High levels of isoform 1b, isoform 1c, isoform 3a and isoform 4 accumulate in early egg chambers and at stage 9 become concentrated at the posterior of the oocyte. Isoform 5a and isoform 5b are highly expressed in adult head and to a lesser extent in adult torso. Isoform 1a, isoform 2a and isoform 2b are found in all tissues examined, including ovaries, midgut, torso and head.2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed both maternally and zygotically. Abundant in embryos and adults, low levels in larva and pupae. Isoform 1a, isoform 2a and isoform 2b are constitutively expressed at high levels and isoform 2c at low levels in embryos and adults.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		FBgn0003654, Expressed in arthropod fat body and 21 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q24246, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q24246, DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. The cytoplasmic dynein 1 complex consists of two catalytic heavy chains (HCs) and a number of non-catalytic subunits presented by intermediate chains (ICs), light intermediate chains (LICs) and light chains (LCs).

By similarity

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		68871, 25 interactors

Database of interacting proteins

More...DIPi		DIP-19664N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		Q24246

Protein interaction database and analysis system

More...IntActi		Q24246, 6 interactors

STRING: functional protein association networks

More...STRINGi		7227.FBpp0088428

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1663
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

AlphaFold Protein Structure Database

More...AlphaFoldDBi		Q24246

Biological Magnetic Resonance Data Bank

More...BMRBi		Q24246

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q24246

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q24246

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati311 – 360WD 1Add BLAST50
Repeati364 – 404WD 2Add BLAST41
Repeati413 – 454WD 3Add BLAST42
Repeati463 – 503WD 4Add BLAST41
Repeati508 – 553WD 5Add BLAST46
Repeati556 – 596WD 6Add BLAST41
Repeati602 – 641WD 7Add BLAST40

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni17 – 52DisorderedSequence analysisAdd BLAST36
Regioni75 – 107DisorderedSequence analysisAdd BLAST33

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi17 – 36Basic and acidic residuesSequence analysisAdd BLAST20

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the dynein intermediate chain family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1587, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000166605

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q24246

Identification of Orthologs from Complete Genome Data

More...OMAi		EEGSIYP

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q24246

Family and domain databases

Database of protein disorder

More...DisProti		DP00605

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.130.10.10, 2 hits

Intrinsically Disordered proteins with Extensive Annotations and Literature

More...IDEALi		IID50052

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR025956, DYNC1I1/DYNC1I2
IPR015943, WD40/YVTN_repeat-like_dom_sf
IPR001680, WD40_repeat
IPR036322, WD40_repeat_dom_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF11540, Dynein_IC2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00320, WD40, 6 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50978, SSF50978, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50082, WD_REPEATS_2, 1 hit
PS50294, WD_REPEATS_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (11+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 11 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 11 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 5a (identifier: Q24246-11) [UniParc]FASTAAdd to basket
Also known as: J

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDRKAELERK KAKLAALREE KDRRRREKEI KDMEEAAGRI GGGAGIDKDQ 
        60         70         80         90        100
RKDLDEMLSS LGVAPVSEVL SSLSSVNSMT SDNSNTQTPD ASLQATVNGQ 
       110        120        130        140        150
SGGKKQPLNL SVYNVQATNI PPKETLVYTK QTQTTSTGGG NGDVLSCHSS 
       160        170        180        190        200
PLSGYMEDWW RPRKAHATDY YDEYNLNPGL EWEDEFTDDE ESSLQNLGNG 
       210        220        230        240        250
FTSKLPPGYL THGLPTVKDV APAITPLEIK KETEVKKEVN ELSEEQKQMI 
       260        270        280        290        300
ILSENFQRFV VRAGRVIERA LSENVDIYTD YIGGGDSEEA NDERSHARLS 
       310        320        330        340        350
LNRVFYDERW SKNRCITSMD WSTHFPELVV GSYHNNEESP NEPDGVVMVW 
       360        370        380        390        400
NTKFKKSTPE DVFHCQSAVM STCFAKFNPN LILGGTYSGQ IVLWDNRVQK 
       410        420        430        440        450
RTPIQRTPLS AAAHTHPVYC LQMVGTQNAH NVISISSDGK LCSWSLDMLS 
       460        470        480        490        500
QPQDTLELQQ RQSKAIAITS MAFPANEINS LVMGSEDGYV YSASRHGLRS 
       510        520        530        540        550
GVNEVYERHL GPITGISTHY NQLSPDFGHL FLTSSIDWTI KLWSLKDTKP 
       560        570        580        590        600
LYSFEDNSDY VMDVAWSPVH PALFAAVDGS GRLDLWNLNQ DTEVPTASIV 
       610        620        630        640        650
VAGAPALNRV SWTPSGLHVC IGDEAGKLYV YDVAENLAQP SRDEWSRFNT 
       660 
HLSEIKMNQS DEV
Length:663
Mass (Da):73,917
Last modified:July 3, 2003 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4C726D4C5F47FAF7
GO
Isoform 1a (identifier: Q24246-2) [UniParc]FASTAAdd to basket
Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     144-187: VLSCHSSPLSGYMEDWWRPRKAHATDYYDEYNLNPGLEWEDEFT → AHATDYYVLAFDAQG

Show »
Length:634
Mass (Da):70,249
Checksum:iF3267D4090F25E05
GO
Isoform 1b (identifier: Q24246-3) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     144-187: VLSCHSSPLSGYMEDWWRPRKAHATDYYDEYNLNPGLEWEDEFT → AHATDYYG

Show »
Length:627
Mass (Da):69,505
Checksum:iAB436F70A431915B
GO
Isoform 1c (identifier: Q24246-4) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     144-187: VLSCHSSPLSGYMEDWWRPRKAHATDYYDEYNLNPGLEWEDEFT → AHATDYY

Show »
Length:626
Mass (Da):69,447
Checksum:iD96D9CD9AA89814A
GO
Isoform 2a (identifier: Q24246-5) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     144-164: Missing.
     187-187: T → TG

Show »
Length:643
Mass (Da):71,458
Checksum:i900A25F62B24A451
GO
Isoform 2b (identifier: Q24246-6) [UniParc]FASTAAdd to basket
Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     144-164: Missing.

Show »
Length:642
Mass (Da):71,400
Checksum:i10271A56BFBC8B62
GO
Isoform 2c (identifier: Q24246-7) [UniParc]FASTAAdd to basket
Also known as: F

The sequence of this isoform differs from the canonical sequence as follows:
     144-164: Missing.
     187-187: T → TVLAFDAQG

Show »
Length:650
Mass (Da):72,202
Checksum:i937440311CA820DE
GO
Isoform 3a (identifier: Q24246-8) [UniParc]FASTAAdd to basket
Also known as: G

The sequence of this isoform differs from the canonical sequence as follows:
     144-171: Missing.
     187-187: T → TG

Show »
Length:636
Mass (Da):70,636
Checksum:i10882999594FBDD9
GO
Isoform 3b (identifier: Q24246-9) [UniParc]FASTAAdd to basket
Also known as: H

The sequence of this isoform differs from the canonical sequence as follows:
     144-171: Missing.

Show »
Length:635
Mass (Da):70,579
Checksum:i422B7524D4A50381
GO
Isoform 4 (identifier: Q24246-10) [UniParc]FASTAAdd to basket
Also known as: I

The sequence of this isoform differs from the canonical sequence as follows:
     146-187: SCHSSPLSGYMEDWWRPRKAHATDYYDEYNLNPGLEWEDEFT → AFDAQG

Show »
Length:627
Mass (Da):69,428
Checksum:i6D17F8435B8C8BF8
GO
Isoform 5b (identifier: Q24246-12) [UniParc]FASTAAdd to basket
Also known as: K

The sequence of this isoform differs from the canonical sequence as follows:
     144-153: Missing.

Show »
Length:653
Mass (Da):72,906
Checksum:i3073C8F8F3B2FB59
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A4V4T4A4V4T4_DROME
SD27396p
sw 17-234, Cdic, cDIC, Cdic2b, DIC
643Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E8NH77E8NH77_DROME
SD15168p
sw 17-234, Cdic, cDIC, Cdic2b, DIC
634Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
X2JLF7X2JLF7_DROME
Short wing, isoform O
sw 17-234, Cdic, cDIC, Cdic2b, DIC
643Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC70942 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAC78306 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti47D → G in AAC78306 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70933 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70934 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70935 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70936 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70937 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70938 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70939 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70940 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70941 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70942 (PubMed:9774695).Curated1
Sequence conflicti47D → G in AAC70943 (PubMed:9774695).Curated1
Sequence conflicti139 – 145GGNGDVL → AETAMV in AAB51185 (Ref. 6) Curated7
Sequence conflicti235V → L in AAB51185 (Ref. 6) Curated1
Sequence conflicti296 – 297HA → SM in AAB51185 (Ref. 6) Curated2
Sequence conflicti521 – 522NQ → KP in AAB51185 (Ref. 6) Curated2
Sequence conflicti537 – 548DWTIK…SLKDT → KIWSLKLPISSCQFSVVSGI NSN in AAB51185 (Ref. 6) CuratedAdd BLAST12
Sequence conflicti579G → A in AAB51185 (Ref. 6) Curated1
Sequence conflicti593E → K in AAB51185 (Ref. 6) Curated1
Sequence conflicti628L → Q in AAB51185 (Ref. 6) Curated1
Sequence conflicti645 – 663WSRFN…QSDEV → IKMNQSVRSRTI in AAB51185 (Ref. 6) CuratedAdd BLAST19

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_001345144 – 187VLSCH…EDEFT → AHATDYYVLAFDAQG in isoform 1a. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_001346144 – 187VLSCH…EDEFT → AHATDYYG in isoform 1b. 2 PublicationsAdd BLAST44
Alternative sequenceiVSP_001347144 – 187VLSCH…EDEFT → AHATDYY in isoform 1c. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_001342144 – 171Missing in isoform 3a and isoform 3b. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_007686144 – 164Missing in isoform 2a, isoform 2b and isoform 2c. 2 PublicationsAdd BLAST21
Alternative sequenceiVSP_007685144 – 153Missing in isoform 5b. 1 Publication10
Alternative sequenceiVSP_001343146 – 187SCHSS…EDEFT → AFDAQG in isoform 4. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_001348187T → TG in isoform 2a and isoform 3a. 1 Publication1
Alternative sequenceiVSP_007687187T → TVLAFDAQG in isoform 2c. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF070687 Genomic DNA Translation: AAC78306.1 Sequence problems.
AF070689 mRNA Translation: AAC70933.1
AF070690 mRNA Translation: AAC70934.1
AF070691 mRNA Translation: AAC70935.1
AF070692 mRNA Translation: AAC70936.1
AF070693 mRNA Translation: AAC70937.1
AF070694 mRNA Translation: AAC70938.1
AF070695 mRNA Translation: AAC70939.1
AF070696 mRNA Translation: AAC70940.1
AF070697 mRNA Translation: AAC70941.1
AF070698 mRNA Translation: AAC70942.1 Sequence problems.
AF070699 mRNA Translation: AAC70943.1
AF263371 mRNA Translation: AAF73046.1
AE014298 Genomic DNA Translation: AAF50928.2
AE014298 Genomic DNA Translation: AAN09553.1
AE014298 Genomic DNA Translation: AAN09554.1
AE014298 Genomic DNA Translation: AAN09555.1
AE014298 Genomic DNA Translation: AAN09556.1
AE014298 Genomic DNA Translation: AAN09557.1
AE014298 Genomic DNA Translation: AAN09558.1
AE014298 Genomic DNA Translation: AAN09559.1
AE014298 Genomic DNA Translation: AAN09560.1
AE014298 Genomic DNA Translation: AAN09561.1
AE014298 Genomic DNA Translation: AAN09562.1
BT016101 mRNA Translation: AAV36986.1
L41945 Genomic DNA Translation: AAB51185.1

NCBI Reference Sequences

More...RefSeqi		NP_001285486.1, NM_001298557.1 [Q24246-2]
NP_477069.1, NM_057721.4 [Q24246-5]
NP_477070.1, NM_057722.4 [Q24246-8]
NP_477071.1, NM_057723.4 [Q24246-9]
NP_477072.1, NM_057724.4 [Q24246-10]
NP_477073.1, NM_057725.4 [Q24246-12]
NP_477074.1, NM_057726.4 [Q24246-2]
NP_477075.2, NM_057727.5 [Q24246-11]
NP_477076.1, NM_057728.4 [Q24246-4]
NP_477077.1, NM_057729.4 [Q24246-3]
NP_477078.1, NM_057730.5 [Q24246-6]
NP_477079.1, NM_057731.4 [Q24246-7]
NP_996521.1, NM_206798.2 [Q24246-5]
NP_996522.1, NM_206799.2 [Q24246-5]

Genome annotation databases

Ensembl metazoan genome annotation project

More...EnsemblMetazoai		FBtr0089397; FBpp0088419; FBgn0003654 [Q24246-2]
FBtr0089398; FBpp0088420; FBgn0003654 [Q24246-3]
FBtr0089399; FBpp0088421; FBgn0003654 [Q24246-4]
FBtr0089400; FBpp0088422; FBgn0003654 [Q24246-5]
FBtr0089401; FBpp0088423; FBgn0003654 [Q24246-6]
FBtr0089402; FBpp0088424; FBgn0003654 [Q24246-7]
FBtr0089403; FBpp0088425; FBgn0003654 [Q24246-8]
FBtr0089404; FBpp0088426; FBgn0003654 [Q24246-9]
FBtr0089405; FBpp0088427; FBgn0003654 [Q24246-10]
FBtr0089406; FBpp0088428; FBgn0003654 [Q24246-11]
FBtr0089407; FBpp0088429; FBgn0003654 [Q24246-12]
FBtr0089408; FBpp0089020; FBgn0003654 [Q24246-5]
FBtr0089409; FBpp0089021; FBgn0003654 [Q24246-5]
FBtr0340360; FBpp0309318; FBgn0003654 [Q24246-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		44160

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		dme:Dmel_CG18000

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF070687 Genomic DNA Translation: AAC78306.1 Sequence problems.
AF070689 mRNA Translation: AAC70933.1
AF070690 mRNA Translation: AAC70934.1
AF070691 mRNA Translation: AAC70935.1
AF070692 mRNA Translation: AAC70936.1
AF070693 mRNA Translation: AAC70937.1
AF070694 mRNA Translation: AAC70938.1
AF070695 mRNA Translation: AAC70939.1
AF070696 mRNA Translation: AAC70940.1
AF070697 mRNA Translation: AAC70941.1
AF070698 mRNA Translation: AAC70942.1 Sequence problems.
AF070699 mRNA Translation: AAC70943.1
AF263371 mRNA Translation: AAF73046.1
AE014298 Genomic DNA Translation: AAF50928.2
AE014298 Genomic DNA Translation: AAN09553.1
AE014298 Genomic DNA Translation: AAN09554.1
AE014298 Genomic DNA Translation: AAN09555.1
AE014298 Genomic DNA Translation: AAN09556.1
AE014298 Genomic DNA Translation: AAN09557.1
AE014298 Genomic DNA Translation: AAN09558.1
AE014298 Genomic DNA Translation: AAN09559.1
AE014298 Genomic DNA Translation: AAN09560.1
AE014298 Genomic DNA Translation: AAN09561.1
AE014298 Genomic DNA Translation: AAN09562.1
BT016101 mRNA Translation: AAV36986.1
L41945 Genomic DNA Translation: AAB51185.1
RefSeqiNP_001285486.1, NM_001298557.1 [Q24246-2]
NP_477069.1, NM_057721.4 [Q24246-5]
NP_477070.1, NM_057722.4 [Q24246-8]
NP_477071.1, NM_057723.4 [Q24246-9]
NP_477072.1, NM_057724.4 [Q24246-10]
NP_477073.1, NM_057725.4 [Q24246-12]
NP_477074.1, NM_057726.4 [Q24246-2]
NP_477075.2, NM_057727.5 [Q24246-11]
NP_477076.1, NM_057728.4 [Q24246-4]
NP_477077.1, NM_057729.4 [Q24246-3]
NP_477078.1, NM_057730.5 [Q24246-6]
NP_477079.1, NM_057731.4 [Q24246-7]
NP_996521.1, NM_206798.2 [Q24246-5]
NP_996522.1, NM_206799.2 [Q24246-5]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2P2TX-ray3.00C123-138[»]
3FM7X-ray3.50C/D109-135[»]
3L9KX-ray3.00W/X/Y/Z242-279[»]
AlphaFoldDBiQ24246
BMRBiQ24246
SMRiQ24246
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi68871, 25 interactors
DIPiDIP-19664N
ELMiQ24246
IntActiQ24246, 6 interactors
STRINGi7227.FBpp0088428

Proteomic databases

PaxDbiQ24246
PRIDEiQ24246

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		44160

Genome annotation databases

EnsemblMetazoaiFBtr0089397; FBpp0088419; FBgn0003654 [Q24246-2]
FBtr0089398; FBpp0088420; FBgn0003654 [Q24246-3]
FBtr0089399; FBpp0088421; FBgn0003654 [Q24246-4]
FBtr0089400; FBpp0088422; FBgn0003654 [Q24246-5]
FBtr0089401; FBpp0088423; FBgn0003654 [Q24246-6]
FBtr0089402; FBpp0088424; FBgn0003654 [Q24246-7]
FBtr0089403; FBpp0088425; FBgn0003654 [Q24246-8]
FBtr0089404; FBpp0088426; FBgn0003654 [Q24246-9]
FBtr0089405; FBpp0088427; FBgn0003654 [Q24246-10]
FBtr0089406; FBpp0088428; FBgn0003654 [Q24246-11]
FBtr0089407; FBpp0088429; FBgn0003654 [Q24246-12]
FBtr0089408; FBpp0089020; FBgn0003654 [Q24246-5]
FBtr0089409; FBpp0089021; FBgn0003654 [Q24246-5]
FBtr0340360; FBpp0309318; FBgn0003654 [Q24246-2]
GeneIDi44160
KEGGidme:Dmel_CG18000

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		44160
FlyBaseiFBgn0003654, sw
VEuPathDBiVectorBase:FBgn0003654

Phylogenomic databases

eggNOGiKOG1587, Eukaryota
GeneTreeiENSGT00940000166605
InParanoidiQ24246
OMAiEEGSIYP
PhylomeDBiQ24246

Enzyme and pathway databases

ReactomeiR-DME-3371497, HSP90 chaperone cycle for steroid hormone receptors (SHR) in the presence of ligand
R-DME-6807878, COPI-mediated anterograde transport
R-DME-6811436, COPI-independent Golgi-to-ER retrograde traffic
R-DME-9646399, Aggrephagy
SignaLinkiQ24246

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		44160, 0 hits in 3 CRISPR screens
EvolutionaryTraceiQ24246

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		44160

Protein Ontology

More...PROi		PR:Q24246

Gene expression databases

BgeeiFBgn0003654, Expressed in arthropod fat body and 21 other tissues
ExpressionAtlasiQ24246, baseline and differential
GenevisibleiQ24246, DM

Family and domain databases

DisProtiDP00605
Gene3Di2.130.10.10, 2 hits
IDEALiIID50052
InterProiView protein in InterPro
IPR025956, DYNC1I1/DYNC1I2
IPR015943, WD40/YVTN_repeat-like_dom_sf
IPR001680, WD40_repeat
IPR036322, WD40_repeat_dom_sf
PfamiView protein in Pfam
PF11540, Dynein_IC2, 1 hit
SMARTiView protein in SMART
SM00320, WD40, 6 hits
SUPFAMiSSF50978, SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS50082, WD_REPEATS_2, 1 hit
PS50294, WD_REPEATS_REGION, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDYIN_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q24246
Secondary accession number(s): O96508
, O96510, O96511, O96512, O96513, O96514, O96515, O96516, Q5U0Z1, Q86BQ5, Q9NG49, Q9TZR7, Q9TZR8, Q9TZR9, Q9TZS0, Q9VR78
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: July 3, 2003
Last modified: May 25, 2022
This is version 206 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again