Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 151 (12 Aug 2020)
Sequence version 6 (05 Oct 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Calcium-dependent secretion activator

Gene

unc-31

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Calcium-binding protein involved in exocytosis of vesicles filled with neurotransmitters and neuropeptides. Probably acts upstream of fusion in the biogenesis or maintenance of mature secretory vesicles. May specifically mediate the Ca2+-dependent exocytosis of large dense-core vesicles (DCVs) and other dense-core vesicles (By similarity). Specifically required to activate the neuronal G-alpha pathway. Functions with G-alpha proteins from the same motor neurons to regulate locomotion (PubMed:16272411). Involved in regulating entry into quiescence triggered by satiety (PubMed:18316030). Probably by regulating neuronal transmission downstream of lin-3 and receptor lin-23 and phospholipase plc-3 and upstream of innexin unc-7 and egl-4/PKG in ALA neurons, involved in the decrease in pharyngeal pumping during the quiescent state that precedes each larval molt (PubMed:17891142). Plays a role in octopamine signaling and specifically, the octopamine inhibition of aversion responses in olfactory sensory neurons (PubMed:22124329). Probably by controlling the secretion of FLP neuropeptides, regulates the turning step of male mating behavior (PubMed:17611271).By similarity5 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processExocytosis, Protein transport, Transport
LigandCalcium, Lipid-binding, Metal-binding

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.F.1.1.3, the synaptosomal vesicle fusion pore (svf-pore) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calcium-dependent secretion activator
Alternative name(s):
Uncoordinated protein 31
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:unc-31
ORF Names:ZK897.1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome IV

Organism-specific databases

WormBase

More...
WormBasei
ZK897.1a ; CE44675 ; WBGene00006767 ; unc-31
ZK897.1b ; CE44637 ; WBGene00006767 ; unc-31
ZK897.1c ; CE44563 ; WBGene00006767 ; unc-31
ZK897.1d ; CE44694 ; WBGene00006767 ; unc-31
ZK897.1e ; CE44651 ; WBGene00006767 ; unc-31
ZK897.1f ; CE44601 ; WBGene00006767 ; unc-31

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell junction, Cytoplasmic vesicle, Membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Worms display increased adult life span and constitutive dauer formation (PubMed:10377425). RNAi-mediated knockdown in ADL sensory neurons results in reduced octopamine inhibition of the aversive response when animals are exposed to 100% 1-octanol (PubMed:22124329).2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000538711 – 1378Calcium-dependent secretion activatorAdd BLAST1378

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q23658

PeptideAtlas

More...
PeptideAtlasi
Q23658

PRoteomics IDEntifications database

More...
PRIDEi
Q23658

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Within the ventral, dorsal and sublateral nerve cords, it is concentrated in cholinergic synapses. Within the ventral and dorsal nerve cords, it is not concentrated at most non-cholinergic synapses in the nerve cords, such as the GABAergic, glutamatergic, and catecholaminergic synapses. However, within the nerve ring, which contains a large number of interneuronal synapses in the head, it is clearly concentrated in regions containing large numbers of non-cholinergic synapses.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00006767, Expressed in multi-cellular organism and 4 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q23658, baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
6239.ZK897.1i

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q23658

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini430 – 547C2PROSITE-ProRule annotationAdd BLAST118
Domaini569 – 675PHPROSITE-ProRule annotationAdd BLAST107
Domaini964 – 1095MHD1PROSITE-ProRule annotationAdd BLAST132

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili121 – 184Sequence analysisAdd BLAST64

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PH domain is essential for regulated exocytosis and binds phospholipids.By similarity

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3543, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00590000083094

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q23658

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q23658

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit
2.60.40.150, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035892, C2_domain_sf
IPR033227, CAPS
IPR010439, CAPS_dom
IPR014770, Munc13_1
IPR011993, PH-like_dom_sf
IPR001849, PH_domain

The PANTHER Classification System

More...
PANTHERi
PTHR12166, PTHR12166, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06292, DUF1041, 1 hit
PF00169, PH, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01145, DUF1041, 1 hit
SM00233, PH, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50004, C2, 1 hit
PS51258, MHD1, 1 hit
PS50003, PH_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 13 potential isoforms that are computationally mapped.Show allAlign All

Isoform c (identifier: Q23658-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLGASSSEEE DDDFQEDHDS LPIAQVKKRS LLSGAMTPRS SSPAPSDSVS
60 70 80 90 100
QTNSLKRNNS SSQGRRKDSV QSQTPARSAR IMSNVSKPIM QNSQEFDGDE
110 120 130 140 150
EEGEEGSTTV VGSGDECGGP ALSKEEQERM KAEREEEDHK KNLQMYMFLA
160 170 180 190 200
RCIAYPFNGQ QTGDMARRQM KVNKQELARI RERFTLFLKG ETNIAADEAF
210 220 230 240 250
TKAIQSYFEV FLKSERVQKV VHAGGFSQHD FREVFRLNIE KRVRSLPDIE
260 270 280 290 300
GLSKDTVLNS WLAKFDAIIK GDETDQNRNA RGRSRNPQNA MSADAVLGKE
310 320 330 340 350
QLYDVFQQIL GVKKFEHQII FNALQLDNPD EQAAAIRREF ATREEALKDP
360 370 380 390 400
IKMKRLTPKF VVKDMETLYM DEVRMSINTL IGNLETVPVT TRGATVGKRK
410 420 430 440 450
DKSRSRSIED LSLFNSLKRR TSSGSLNKGD SEDGDVTLTK SDVSLALSME
460 470 480 490 500
VVVMEVQGLK SVQPSKIVYC TMEVDGHKLQ TDHAEASKPK WDTQGDFSTK
510 520 530 540 550
NPLPVVKVKL YTEVKSMIAF EDKELGKVII QPTPNCARSP EWYTMTLPKS
560 570 580 590 600
SQDQNLKIRI AIRVEKPPNL KYCGYCYCIG RNAWKKWKKR FFCLVQVSQY
610 620 630 640 650
AFAVCSFRQK KADPTEFIQL DGFTIDYMPE SDPELSAQGG KHFFTAIKEG
660 670 680 690 700
DELKFATDDE NERHLWVQAL YRATGQAYKP VPPKQSTIAP KAQGFQDKAS
710 720 730 740 750
KHGMDAMIQA DSINFDHDHF YSDVQRLTLD FRINEPICSL GWFSPGQAFV
760 770 780 790 800
LEEYSARYMV RGCFRHVTLL SNLLDKADDG LLIDPALIHY SFAFCASHVH
810 820 830 840 850
GNRCMPDRQG PEGVGTVTLE EKEKFQEIKE RLRVLLEKQI TNFRYCFPFG
860 870 880 890 900
RPEGALKGTL GLLERVLMKD VVSPVPPEEV RAVIRKCLED AALVNYTRIC
910 920 930 940 950
NEAKIEQRMG IDVSPAQRIE DMIRVTEFCI DLLKENEEHH GEAFAWFSDL
960 970 980 990 1000
LSDHSEIFWS LYSVDLDSAL EVQPHDSWDS FPLFQMLNDF LLSESSLKGG
1010 1020 1030 1040 1050
IFHNKIVQQF QPLVVRYIDL MEHSIAQAID KGFSKEKWES RKEGCATSED
1060 1070 1080 1090 1100
IYWKLDALHT FVIDLNWPEE DFRKYLQTKM KSLTSDMISK VSDCTFTAFD
1110 1120 1130 1140 1150
SWMQRAKKST DYMLPSEVCV QINVMFSSKS RAVRVTVDSG EYKYQSKLDE
1160 1170 1180 1190 1200
TLETMLKTME SCIQEKLHGV LESVLSRLAR YDEGNPIGAI LNIAPKPASI
1210 1220 1230 1240 1250
FNKLKTMAGD TSAQATTTAR QPLTAQQSSG QIGNSYVTFF HGCTELLRQV
1260 1270 1280 1290 1300
IIDEIWVNGL FEHWYDNQMK SINEWLTERL QQSLSATQYI SLSTIVKKVY
1310 1320 1330 1340 1350
QDFSLQGIDE ERLNSKTYQS ISRRLQLEES NSHIQEAAIN GSAQGSVFPT
1360 1370
SLGNATAAVS NMSSMVEGAG AKMFSLFK
Length:1,378
Mass (Da):156,188
Last modified:October 5, 2010 - v6
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3FDC1CDED2BD3AE7
GO
Isoform a (identifier: Q23658-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     78-78: S → SPMRMNAPSPMPQ
     1337-1378: AAINGSAQGSVFPTSLGNATAAVSNMSSMVEGAGAKMFSLFK → GIRKH

Show »
Length:1,353
Mass (Da):154,028
Checksum:i93C8A40E512B1613
GO
Isoform b (identifier: Q23658-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1337-1378: AAINGSAQGSVFPTSLGNATAAVSNMSSMVEGAGAKMFSLFK → GIRKH

Show »
Length:1,341
Mass (Da):152,689
Checksum:i91E83BBBFA4D878C
GO
Isoform d (identifier: Q23658-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-448: Missing.
     1337-1378: AAINGSAQGSVFPTSLGNATAAVSNMSSMVEGAGAKMFSLFK → GIRKH

Show »
Length:893
Mass (Da):102,396
Checksum:i19221327E16E9015
GO
Isoform e (identifier: Q23658-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-448: Missing.

Show »
Length:930
Mass (Da):105,895
Checksum:i7462F34FD8CC5859
GO
Isoform f (identifier: Q23658-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1361: Missing.

Show »
Length:17
Mass (Da):1,821
Checksum:i19D3A5FBEA17ECA4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 13 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H9G2V2H9G2V2_CAEEL
Calcium-dependent secretion activat...
unc-31 CELE_ZK897.1, ZK897.1
1,385Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H9G2V3H9G2V3_CAEEL
Calcium-dependent secretion activat...
unc-31 CELE_ZK897.1, ZK897.1
1,366Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3MU01G3MU01_CAEEL
Calcium-dependent secretion activat...
unc-31 CELE_ZK897.1, ZK897.1
110Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A061AKP8A0A061AKP8_CAEEL
Calcium-dependent secretion activat...
unc-31 CELE_ZK897.1, ZK897.1
1,401Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A061ACJ2A0A061ACJ2_CAEEL
Calcium-dependent secretion activat...
unc-31 CELE_ZK897.1, ZK897.1
1,390Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A061ACJ8A0A061ACJ8_CAEEL
Calcium-dependent secretion activat...
unc-31 CELE_ZK897.1, ZK897.1
1,370Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A061ACM4A0A061ACM4_CAEEL
Calcium-dependent secretion activat...
unc-31 CELE_ZK897.1, ZK897.1
1,397Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A061ACM9A0A061ACM9_CAEEL
Calcium-dependent secretion activat...
unc-31 CELE_ZK897.1, ZK897.1
1,389Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A061ADT8A0A061ADT8_CAEEL
Calcium-dependent secretion activat...
unc-31 CELE_ZK897.1, ZK897.1
1,394Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A061ADU4A0A061ADU4_CAEEL
Calcium-dependent secretion activat...
unc-31 CELE_ZK897.1, ZK897.1
1,382Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0397741 – 1361Missing in isoform f. CuratedAdd BLAST1361
Alternative sequenceiVSP_0397751 – 448Missing in isoform d and isoform e. CuratedAdd BLAST448
Alternative sequenceiVSP_03977678S → SPMRMNAPSPMPQ in isoform a. Curated1
Alternative sequenceiVSP_0397771337 – 1378AAING…FSLFK → GIRKH in isoform a, isoform b and isoform d. CuratedAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Z69665 Genomic DNA Translation: CAA93520.6
Z69665 Genomic DNA Translation: CAX65097.2
Z69665 Genomic DNA Translation: CBK19526.1
Z69665 Genomic DNA Translation: CBK19527.1
Z69665 Genomic DNA Translation: CBK19528.1
Z69665 Genomic DNA Translation: CBK19529.1

Protein sequence database of the Protein Information Resource

More...
PIRi
H88869
T28087

NCBI Reference Sequences

More...
RefSeqi
NP_001255664.1, NM_001268735.1 [Q23658-3]
NP_001255666.1, NM_001268737.1 [Q23658-1]
NP_001255667.1, NM_001268738.1 [Q23658-2]
NP_001255668.1, NM_001268739.1 [Q23658-5]
NP_001255669.1, NM_001268740.1 [Q23658-4]
NP_001255671.1, NM_001268742.1 [Q23658-6]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
ZK897.1a.1; ZK897.1a.1; WBGene00006767 [Q23658-1]
ZK897.1b.1; ZK897.1b.1; WBGene00006767 [Q23658-2]
ZK897.1c.1; ZK897.1c.1; WBGene00006767 [Q23658-3]
ZK897.1d.1; ZK897.1d.1; WBGene00006767 [Q23658-4]
ZK897.1e.1; ZK897.1e.1; WBGene00006767 [Q23658-5]
ZK897.1f.1; ZK897.1f.1; WBGene00006767 [Q23658-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
178233

UCSC genome browser

More...
UCSCi
ZK897.1, c. elegans [Q23658-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z69665 Genomic DNA Translation: CAA93520.6
Z69665 Genomic DNA Translation: CAX65097.2
Z69665 Genomic DNA Translation: CBK19526.1
Z69665 Genomic DNA Translation: CBK19527.1
Z69665 Genomic DNA Translation: CBK19528.1
Z69665 Genomic DNA Translation: CBK19529.1
PIRiH88869
T28087
RefSeqiNP_001255664.1, NM_001268735.1 [Q23658-3]
NP_001255666.1, NM_001268737.1 [Q23658-1]
NP_001255667.1, NM_001268738.1 [Q23658-2]
NP_001255668.1, NM_001268739.1 [Q23658-5]
NP_001255669.1, NM_001268740.1 [Q23658-4]
NP_001255671.1, NM_001268742.1 [Q23658-6]

3D structure databases

SMRiQ23658
ModBaseiSearch...

Protein-protein interaction databases

STRINGi6239.ZK897.1i

Protein family/group databases

TCDBi1.F.1.1.3, the synaptosomal vesicle fusion pore (svf-pore) family

Proteomic databases

PaxDbiQ23658
PeptideAtlasiQ23658
PRIDEiQ23658

Genome annotation databases

EnsemblMetazoaiZK897.1a.1; ZK897.1a.1; WBGene00006767 [Q23658-1]
ZK897.1b.1; ZK897.1b.1; WBGene00006767 [Q23658-2]
ZK897.1c.1; ZK897.1c.1; WBGene00006767 [Q23658-3]
ZK897.1d.1; ZK897.1d.1; WBGene00006767 [Q23658-4]
ZK897.1e.1; ZK897.1e.1; WBGene00006767 [Q23658-5]
ZK897.1f.1; ZK897.1f.1; WBGene00006767 [Q23658-6]
GeneIDi178233
UCSCiZK897.1, c. elegans [Q23658-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
178233
WormBaseiZK897.1a ; CE44675 ; WBGene00006767 ; unc-31
ZK897.1b ; CE44637 ; WBGene00006767 ; unc-31
ZK897.1c ; CE44563 ; WBGene00006767 ; unc-31
ZK897.1d ; CE44694 ; WBGene00006767 ; unc-31
ZK897.1e ; CE44651 ; WBGene00006767 ; unc-31
ZK897.1f ; CE44601 ; WBGene00006767 ; unc-31

Phylogenomic databases

eggNOGiKOG3543, Eukaryota
GeneTreeiENSGT00590000083094
InParanoidiQ23658
PhylomeDBiQ23658

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q23658

Gene expression databases

BgeeiWBGene00006767, Expressed in multi-cellular organism and 4 other tissues
ExpressionAtlasiQ23658, baseline and differential

Family and domain databases

Gene3Di2.30.29.30, 1 hit
2.60.40.150, 1 hit
InterProiView protein in InterPro
IPR035892, C2_domain_sf
IPR033227, CAPS
IPR010439, CAPS_dom
IPR014770, Munc13_1
IPR011993, PH-like_dom_sf
IPR001849, PH_domain
PANTHERiPTHR12166, PTHR12166, 1 hit
PfamiView protein in Pfam
PF06292, DUF1041, 1 hit
PF00169, PH, 1 hit
SMARTiView protein in SMART
SM01145, DUF1041, 1 hit
SM00233, PH, 1 hit
PROSITEiView protein in PROSITE
PS50004, C2, 1 hit
PS51258, MHD1, 1 hit
PS50003, PH_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCAPS_CAEEL
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q23658
Secondary accession number(s): C1P637
, D3YT40, D3YT41, D3YT42, D3YT43
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: October 5, 2010
Last modified: August 12, 2020
This is version 151 of the entry and version 6 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again