Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 107 (16 Oct 2019)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Rab3 GTPase-activating protein regulatory subunit

Gene

rbg-2

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Protein inferred from homologyi <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable regulatory subunit of a GTPase activating protein that has specificity for Rab3 subfamily. Rab3 proteins are involved in regulated exocytosis of neurotransmitters and hormones. Rab3 GTPase-activating complex specifically converts active Rab3-GTP to the inactive form Rab3-GDP (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-CEL-6811436 COPI-independent Golgi-to-ER retrograde traffic
R-CEL-8876198 RAB GEFs exchange GTP for GDP on RABs

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rab3 GTPase-activating protein regulatory subunit
Alternative name(s):
Rab3 GTPase-activating protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:rbg-2
ORF Names:T22C1.10
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome I

Organism-specific databases

WormBase

More...
WormBasei
T22C1.10a ; CE06498 ; WBGene00004318 ; rbg-2
T22C1.10b ; CE36203 ; WBGene00004318 ; rbg-2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001916651 – 1307Rab3 GTPase-activating protein regulatory subunitAdd BLAST1307

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q22670

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q22670

PeptideAtlas

More...
PeptideAtlasi
Q22670

PRoteomics IDEntifications database

More...
PRIDEi
Q22670

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00004318 Expressed in 5 organ(s), highest expression level in multi-cellular organism

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The Rab3 GTPase-activating complex is a heterodimer composed of rbg-1 and rbg-2.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
6239.T22C1.10a

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Rab3-GAP regulatory subunit family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2727 Eukaryota
ENOG410XTJ2 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000005794

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000018523

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q22670

KEGG Orthology (KO)

More...
KOi
K19937

Identification of Orthologs from Complete Genome Data

More...
OMAi
ERIYMAP

Database of Orthologous Groups

More...
OrthoDBi
790713at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q22670

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026059 Rab3-gap_reg
IPR029257 RAB3GAP2_C
IPR032839 RAB3GAP_N

The PANTHER Classification System

More...
PANTHERi
PTHR12472 PTHR12472, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF14656 RAB3GAP2_C, 1 hit
PF14655 RAB3GAP2_N, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform a (identifier: Q22670-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSVTPVILEA YCAVSDEVAK QVKKYLLGDF AEESKFERKN SESSDGSETQ
60 70 80 90 100
FCRATEKKEN VEVWDDWGDK EEGAAENSLE SDESIRNWLF RCDLKTYSDA
110 120 130 140 150
EYLLVTWESR FVVLRKPPDE PVYKIVCKQY IEGDPISNEI TASSIFGLSN
160 170 180 190 200
VRHIELLDSI IIALGTLDGH VYFFTEQGTM LYFDRFSIFE PVNSLQFEVV
210 220 230 240 250
KTGQTFIVVF TKGFFMINPI SLKSVLYQAK VLIAKCEKTV KQISESIELQ
260 270 280 290 300
SELLAPDIKG NIIHVIFTGL HKPSTLEQYI SASYDSFYAK VEKPSLPLYS
310 320 330 340 350
TFMVTTEKEF AVFVWHDREE QDKLIDDVIK YGKSLVPSFG IRKFFGISTE
360 370 380 390 400
PARIASHMRS AVHAPTRSII METRVAQNVS RSPDCQYVAV TDRMARVLVI
410 420 430 440 450
DIASRQVVLI FKGYRDASIS WVSVTEDDRV AQFLTIFAPR RSLLEVWTVL
460 470 480 490 500
GNVRVCAQHV PSSECNVVTG GENKMLCGRC HVHTDSNSFF IDEKGEFHRI
510 520 530 540 550
ALPFHLALTS RSRQDQHDHL LLKQLENTKT GGEDWFQTFS DLKMATSRKT
560 570 580 590 600
TFQNALHNLS TAEEAHQFIA RIRSIPTSAS LGDLPNSAEK SIGFYARTVA
610 620 630 640 650
ETKPPVGEYD DKDTSNYKLD SIVERILECH MQKFGERTDM LNDSEVMKVG
660 670 680 690 700
EWLKYVDLSQ EDIDVFSEHW SEKQRHCLAN LIFGPLFGSF EIDEYYDTVL
710 720 730 740 750
EKIPVKRKNI VKLFYMRFEK TTTHIDWRIF NRIVEMFLNL EKSETGILEQ
760 770 780 790 800
VDQMAMDSKD VPLGMILLSI CWCARIQIRI LKGNDEDEVE NDHDLEEEDE
810 820 830 840 850
KNKTIDEWDA ISPEAEHLDC IIMCLHCVSL AQSLLKDDSN ILRISDVVPR
860 870 880 890 900
IDSYIRENVA KWIVSTPIDT DTIEKLFPRD PSENLAEKGN EEDRRKQMII
910 920 930 940 950
DFPDDKEVVI QRMYQIIPRV FEHDLVVADV CWEMMSQWFR EKDDNFSYIK
960 970 980 990 1000
DCTTLLPQSI VDPRLRHGIA RLIWDKFIFM VFQSIVNMVE KTGRRPKDKE
1010 1020 1030 1040 1050
TRKEIGFGEV KLEEFLMECE KFLEVLMDSV RDMPPPIDFK QDLLVEMASS
1060 1070 1080 1090 1100
SFAAHLHQSK TAYRQDQFAI LASRQPLVNF HLVLHHQHLA LALRLQLTTG
1110 1120 1130 1140 1150
LRFHPLRNLF CVTGNRAFFA SLDSHPLIPL DRVDDATMEK RHAFLVKVAE
1160 1170 1180 1190 1200
QGSMEERRLA RHLEMEWKLT VNEISFMQAL SSFRLGNDHQ GSLELASCVR
1210 1220 1230 1240 1250
DDRSAVALAR VLAARLIQLA NEANKRYSTA HSQYLCALAG EEAARVELYE
1260 1270 1280 1290 1300
NSPDDPLVDS NPKTWKDAVT SLGRAGNSVP QSAQAAIPFV RMNDIAKLYF

GAQWVNN
Length:1,307
Mass (Da):149,909
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7DD30FE5066347BE
GO
Isoform b (identifier: Q22670-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MSVTPVILEAYCAVSDEVAKQVKKYLLGDFAEES → MRLPSRLKSICSEISQKT

Note: No experimental confirmation available.
Show »
Length:1,291
Mass (Da):148,252
Checksum:i9760D7220875E91B
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0133141 – 34MSVTP…FAEES → MRLPSRLKSICSEISQKT in isoform b. CuratedAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Z75550 Genomic DNA Translation: CAA99926.1
Z75550 Genomic DNA Translation: CAE54924.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T25106

NCBI Reference Sequences

More...
RefSeqi
NP_001021631.1, NM_001026460.2 [Q22670-1]
NP_001021632.1, NM_001026461.2 [Q22670-2]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
T22C1.10a.1; T22C1.10a.1; WBGene00004318 [Q22670-1]
T22C1.10b.1; T22C1.10b.1; WBGene00004318 [Q22670-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
172574

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
cel:CELE_T22C1.10

UCSC genome browser

More...
UCSCi
T22C1.10b c. elegans [Q22670-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z75550 Genomic DNA Translation: CAA99926.1
Z75550 Genomic DNA Translation: CAE54924.1
PIRiT25106
RefSeqiNP_001021631.1, NM_001026460.2 [Q22670-1]
NP_001021632.1, NM_001026461.2 [Q22670-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi6239.T22C1.10a

Proteomic databases

EPDiQ22670
PaxDbiQ22670
PeptideAtlasiQ22670
PRIDEiQ22670

Genome annotation databases

EnsemblMetazoaiT22C1.10a.1; T22C1.10a.1; WBGene00004318 [Q22670-1]
T22C1.10b.1; T22C1.10b.1; WBGene00004318 [Q22670-2]
GeneIDi172574
KEGGicel:CELE_T22C1.10
UCSCiT22C1.10b c. elegans [Q22670-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
172574
WormBaseiT22C1.10a ; CE06498 ; WBGene00004318 ; rbg-2
T22C1.10b ; CE36203 ; WBGene00004318 ; rbg-2

Phylogenomic databases

eggNOGiKOG2727 Eukaryota
ENOG410XTJ2 LUCA
GeneTreeiENSGT00390000005794
HOGENOMiHOG000018523
InParanoidiQ22670
KOiK19937
OMAiERIYMAP
OrthoDBi790713at2759
PhylomeDBiQ22670

Enzyme and pathway databases

ReactomeiR-CEL-6811436 COPI-independent Golgi-to-ER retrograde traffic
R-CEL-8876198 RAB GEFs exchange GTP for GDP on RABs

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q22670

Gene expression databases

BgeeiWBGene00004318 Expressed in 5 organ(s), highest expression level in multi-cellular organism

Family and domain databases

InterProiView protein in InterPro
IPR026059 Rab3-gap_reg
IPR029257 RAB3GAP2_C
IPR032839 RAB3GAP_N
PANTHERiPTHR12472 PTHR12472, 1 hit
PfamiView protein in Pfam
PF14656 RAB3GAP2_C, 1 hit
PF14655 RAB3GAP2_N, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRBGPR_CAEEL
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q22670
Secondary accession number(s): Q7JLF2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 12, 2005
Last sequence update: November 1, 1996
Last modified: October 16, 2019
This is version 107 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again