Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 170 (26 Feb 2020)
Sequence version 3 (05 Sep 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Nuclear hormone receptor family member nhr-34

Gene

nhr-34

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Orphan nuclear receptor.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi148 – 223Nuclear receptorPROSITE-ProRule annotationAdd BLAST76
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri151 – 171NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri187 – 206NR C4-typePROSITE-ProRule annotationAdd BLAST20

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Receptor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-CEL-383280 Nuclear Receptor transcription pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nuclear hormone receptor family member nhr-34
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:nhr-34
ORF Names:F58G6.5
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome IV

Organism-specific databases

WormBase

More...
WormBasei
F58G6.5a ; CE27764 ; WBGene00003627 ; nhr-34
F58G6.5b ; CE35564 ; WBGene00003627 ; nhr-34
F58G6.5c ; CE35565 ; WBGene00003627 ; nhr-34
F58G6.5d ; CE42612 ; WBGene00003627 ; nhr-34

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000537771 – 631Nuclear hormone receptor family member nhr-34Add BLAST631

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q21006

PeptideAtlas

More...
PeptideAtlasi
Q21006

PRoteomics IDEntifications database

More...
PRIDEi
Q21006

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q21006

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00003627 Expressed in material anatomical entity and 4 other tissues

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
42905, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q21006, 1 interactor

STRING: functional protein association networks

More...
STRINGi
6239.F58G6.5c

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini306 – 581NR LBDPROSITE-ProRule annotationAdd BLAST276

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the nuclear hormone receptor family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri151 – 171NR C4-typePROSITE-ProRule annotationAdd BLAST21
Zinc fingeri187 – 206NR C4-typePROSITE-ProRule annotationAdd BLAST20

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3575 Eukaryota
ENOG410XRZC LUCA

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q21006

Identification of Orthologs from Complete Genome Data

More...
OMAi
EFTGMKC

Database of Orthologous Groups

More...
OrthoDBi
622732at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q21006

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.565.10, 1 hit
3.30.50.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035500 NHR-like_dom_sf
IPR000536 Nucl_hrmn_rcpt_lig-bd
IPR001723 Nuclear_hrmn_rcpt
IPR001628 Znf_hrmn_rcpt
IPR013088 Znf_NHR/GATA

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00104 Hormone_recep, 1 hit
PF00105 zf-C4, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00398 STRDHORMONER
PR00047 STROIDFINGER

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00430 HOLI, 1 hit
SM00399 ZnF_C4, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48508 SSF48508, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51843 NR_LBD, 1 hit
PS00031 NUCLEAR_REC_DBD_1, 1 hit
PS51030 NUCLEAR_REC_DBD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform c (identifier: Q21006-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTDYCIFNIS WMSDRFGCET GNEDVQECID KSPNGSPTTS TTHRRQNSSS
60 70 80 90 100
GLEPARKRPK LSPPVLTAMP LDLTDAVSPN ESQACTSSLK GVVTAAGAAQ
110 120 130 140 150
MSVADRMTSS SVAPPLCIVP RSVEFINPKT EDMSMDIPMG NVQSEFTGLK
160 170 180 190 200
CRVCGDSRAG RHYGTIACNG CKGFFRRSIW EQRDYVCRFG GKCLVVQEYR
210 220 230 240 250
NRCRACRLRK CFTVGMDARA VQSERDKHKK NPKDSNNEGS TSPQYPTAST
260 270 280 290 300
PISIPSTSTS QTPTSSVNSY NFQNIPGIVS RSFSENLIMR DNSVPVMETS
310 320 330 340 350
QSAALSHVPL VRYLIDLEKA TDNLIDENCD FMSMEFDQLC RVDVTIEAAF
360 370 380 390 400
RQPGVVAKRT PPRWLALERL TTLEDVHIAW CRSFVLCIDY AKIMKDYQEL
410 420 430 440 450
SPTDQFTLLR NRVISVNWLC HTYKTFKAGC DGVALVNGSW YPRDKELQKQ
460 470 480 490 500
LDPGCNHYFR ILSEHLMEDL VIPMREMDMD EGEFVILKAL ILFRAHRRLS
510 520 530 540 550
EEGRAHIKRV RDKYIEALYQ HVQHQHRHFS SVQTSMRISK ILLLLPSIEH
560 570 580 590 600
LSQQEDDNVQ FLALFNLANL NGLPYELHSS IKQHIPNGDD SDDTQVNEVT
610 620 630
SNNDGPRSSE SSHTPQSVST SQFLEFKPSL H
Length:631
Mass (Da):71,163
Last modified:September 5, 2006 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF3865DF71DC4D9ED
GO
Isoform a (identifier: Q21006-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: MTDYCIFNISWM → MAESKFSILKGE
     13-144: Missing.

Show »
Length:499
Mass (Da):57,088
Checksum:i2E13343C94AE11D8
GO
Isoform b (identifier: Q21006-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MTDYCIFNISWMSDRFGCETGNEDVQECIDKS → MDDLHQQLHQNYN

Show »
Length:612
Mass (Da):69,080
Checksum:i81A6D3377C258855
GO
Isoform d (identifier: Q21006-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: Missing.

Show »
Length:563
Mass (Da):63,633
Checksum:i5F0B487DC9529DA4
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG15129 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0536311 – 68Missing in isoform d. CuratedAdd BLAST68
Alternative sequenceiVSP_0201551 – 32MTDYC…CIDKS → MDDLHQQLHQNYN in isoform b. CuratedAdd BLAST32
Alternative sequenceiVSP_0037251 – 12MTDYC…NISWM → MAESKFSILKGE in isoform a. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_02015613 – 144Missing in isoform a. 1 PublicationAdd BLAST132

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF273780 mRNA Translation: AAG15129.1 Different initiation.
Z68217 Genomic DNA Translation: CAA92467.2
Z68217 Genomic DNA Translation: CAC70099.2
Z68217, Z68222 Genomic DNA Translation: CAE46673.1
Z68217 Genomic DNA Translation: CAQ58113.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T22948

NCBI Reference Sequences

More...
RefSeqi
NP_001023245.1, NM_001028074.3 [Q21006-3]
NP_001129859.1, NM_001136387.2 [Q21006-4]
NP_501716.2, NM_069315.4
NP_741480.1, NM_171412.3 [Q21006-2]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
F58G6.5a.1; F58G6.5a.1; WBGene00003627 [Q21006-2]
F58G6.5b.1; F58G6.5b.1; WBGene00003627
F58G6.5c.1; F58G6.5c.1; WBGene00003627 [Q21006-3]
F58G6.5d.1; F58G6.5d.1; WBGene00003627 [Q21006-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
177800

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
cel:CELE_F58G6.5

UCSC genome browser

More...
UCSCi
F58G6.5a c. elegans [Q21006-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF273780 mRNA Translation: AAG15129.1 Different initiation.
Z68217 Genomic DNA Translation: CAA92467.2
Z68217 Genomic DNA Translation: CAC70099.2
Z68217, Z68222 Genomic DNA Translation: CAE46673.1
Z68217 Genomic DNA Translation: CAQ58113.1
PIRiT22948
RefSeqiNP_001023245.1, NM_001028074.3 [Q21006-3]
NP_001129859.1, NM_001136387.2 [Q21006-4]
NP_501716.2, NM_069315.4
NP_741480.1, NM_171412.3 [Q21006-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi42905, 4 interactors
IntActiQ21006, 1 interactor
STRINGi6239.F58G6.5c

PTM databases

iPTMnetiQ21006

Proteomic databases

PaxDbiQ21006
PeptideAtlasiQ21006
PRIDEiQ21006

Genome annotation databases

EnsemblMetazoaiF58G6.5a.1; F58G6.5a.1; WBGene00003627 [Q21006-2]
F58G6.5b.1; F58G6.5b.1; WBGene00003627
F58G6.5c.1; F58G6.5c.1; WBGene00003627 [Q21006-3]
F58G6.5d.1; F58G6.5d.1; WBGene00003627 [Q21006-4]
GeneIDi177800
KEGGicel:CELE_F58G6.5
UCSCiF58G6.5a c. elegans [Q21006-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
177800
WormBaseiF58G6.5a ; CE27764 ; WBGene00003627 ; nhr-34
F58G6.5b ; CE35564 ; WBGene00003627 ; nhr-34
F58G6.5c ; CE35565 ; WBGene00003627 ; nhr-34
F58G6.5d ; CE42612 ; WBGene00003627 ; nhr-34

Phylogenomic databases

eggNOGiKOG3575 Eukaryota
ENOG410XRZC LUCA
InParanoidiQ21006
OMAiEFTGMKC
OrthoDBi622732at2759
PhylomeDBiQ21006

Enzyme and pathway databases

ReactomeiR-CEL-383280 Nuclear Receptor transcription pathway

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q21006

Gene expression databases

BgeeiWBGene00003627 Expressed in material anatomical entity and 4 other tissues

Family and domain databases

Gene3Di1.10.565.10, 1 hit
3.30.50.10, 1 hit
InterProiView protein in InterPro
IPR035500 NHR-like_dom_sf
IPR000536 Nucl_hrmn_rcpt_lig-bd
IPR001723 Nuclear_hrmn_rcpt
IPR001628 Znf_hrmn_rcpt
IPR013088 Znf_NHR/GATA
PfamiView protein in Pfam
PF00104 Hormone_recep, 1 hit
PF00105 zf-C4, 1 hit
PRINTSiPR00398 STRDHORMONER
PR00047 STROIDFINGER
SMARTiView protein in SMART
SM00430 HOLI, 1 hit
SM00399 ZnF_C4, 1 hit
SUPFAMiSSF48508 SSF48508, 1 hit
PROSITEiView protein in PROSITE
PS51843 NR_LBD, 1 hit
PS00031 NUCLEAR_REC_DBD_1, 1 hit
PS51030 NUCLEAR_REC_DBD_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNHR34_CAEEL
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q21006
Secondary accession number(s): B3GWB8
, Q7JM21, Q95NU3, Q9GTH8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: September 5, 2006
Last modified: February 26, 2020
This is version 170 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again