Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 87 (08 May 2019)
Sequence version 2 (26 May 2009)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

SKP1-like protein 15

Gene

ASK15

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in ubiquitination and subsequent proteasomal degradation of target proteins. Together with CUL1, RBX1 and a F-box protein, it forms a SCF E3 ubiquitin ligase complex. The functional specificity of this complex depends on the type of F-box protein. In the SCF complex, it serves as an adapter that links the F-box protein to CUL1 (By similarity).By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processUbl conjugation pathway

Enzyme and pathway databases

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
SKP1-like protein 15
Short name:
AtSK15
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ASK15
Ordered Locus Names:At3g25650
ORF Names:T5M7.16
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT3G25650

The Arabidopsis Information Resource

More...
TAIRi
locus:2102370 AT3G25650

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003752561 – 177SKP1-like protein 15Add BLAST177

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q1PEL7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed at low levels in seedlings and leaves.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Highly expressed in the pith and vascular bundle in the stem. Found in the pedicel of young buds. Also expressed in the inner epidermis of carpels and pedicels in mature flowers. In siliques, mostly expressed in inner epidermis of the valve.1 Publication

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q1PEL7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q1PEL7 AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Part of a SCF (SKP1-cullin-F-box) protein ligase complex.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
7483, 3 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-1442 SCF(COI1) ubiquitin ligase complex, variant CUL1-RBX1A-ASK15
CPX-1463 SCF(COI1) ubiquitin ligase complex, variant CUL1-RBX1B-ASK15
CPX-1485 SCF(COI1) ubiquitin ligase complex, variant CUL2-RBX1A-ASK15
CPX-1508 SCF(COI1) ubiquitin ligase complex, variant CUL2-RBX1B-ASK15
CPX-1528 SCF(TIR1) ubiquitin ligase complex, variant CUL1-RBX1A-ASK15
CPX-1549 SCF(TIR1) ubiquitin ligase complex, variant CUL1-RBX1B-ASK15
CPX-1571 SCF(TIR1) ubiquitin ligase complex, variant CUL2-RBX1A-ASK15
CPX-1592 SCF(TIR1) ubiquitin ligase complex, variant CUL2-RBX1B-ASK15

Protein interaction database and analysis system

More...
IntActi
Q1PEL7, 5 interactors

STRING: functional protein association networks

More...
STRINGi
3702.AT3G25650.1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q1PEL7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni108 – 167Interaction with the F-box domain of F-box proteinsBy similarityAdd BLAST60

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SKP1 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1724 Eukaryota
COG5201 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000172184

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q1PEL7

KEGG Orthology (KO)

More...
KOi
K03094

Identification of Orthologs from Complete Genome Data

More...
OMAi
FEIVANM

Database of Orthologous Groups

More...
OrthoDBi
1412723at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q1PEL7

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016897 SKP1
IPR001232 SKP1-like
IPR036296 SKP1-like_dim_sf
IPR011333 SKP1/BTB/POZ_sf
IPR016072 Skp1_comp_dimer
IPR016073 Skp1_comp_POZ

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01466 Skp1, 1 hit
PF03931 Skp1_POZ, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF028729 E3_ubiquit_lig_SCF_Skp, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00512 Skp1, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54695 SSF54695, 1 hit
SSF81382 SSF81382, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q1PEL7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSNKIVLTS SDGESFQVEE VVARKLQIVK HLLEDDCVIN EIPLQNVTGN
60 70 80 90 100
ILSIVLEYCK KHVDDVVDDD ASEEPKKKKP DDEAKQNLDA WDAEFMKNID
110 120 130 140 150
METIFKLILA ANYLNVEGLL GLTCQTVADY IKDKTPEEVR ELFNIENDFT
160 170
HEEEEEAIRK ENAWAFEADT KHEDPKP
Note: Derived from EST data. No experimental confirmation available.
Length:177
Mass (Da):20,254
Last modified:May 26, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i05C92321D745D219
GO
Isoform 2 (identifier: Q1PEL7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     83-112: EAKQNLDAWDAEFMKNIDMETIFKLILAAN → VAGRFLNQLKKEMMHLRRRSRISMLGTQSS
     113-177: Missing.

Note: No experimental confirmation available.
Show »
Length:112
Mass (Da):12,710
Checksum:iEEB774B055076463
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB03085 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03736283 – 112EAKQN…ILAAN → VAGRFLNQLKKEMMHLRRRS RISMLGTQSS in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_037363113 – 177Missing in isoform 2. 1 PublicationAdd BLAST65

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AP001313 Genomic DNA Translation: BAB03085.1 Sequence problems.
CP002686 Genomic DNA Translation: AEE77046.1
DQ446700 mRNA Translation: ABE65968.1

NCBI Reference Sequences

More...
RefSeqi
NP_566773.1, NM_113463.1 [Q1PEL7-1]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT3G25650.1; AT3G25650.1; AT3G25650 [Q1PEL7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
822152

Gramene; a comparative resource for plants

More...
Gramenei
AT3G25650.1; AT3G25650.1; AT3G25650 [Q1PEL7-1]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT3G25650

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AP001313 Genomic DNA Translation: BAB03085.1 Sequence problems.
CP002686 Genomic DNA Translation: AEE77046.1
DQ446700 mRNA Translation: ABE65968.1
RefSeqiNP_566773.1, NM_113463.1 [Q1PEL7-1]

3D structure databases

SMRiQ1PEL7
ModBaseiSearch...

Protein-protein interaction databases

BioGridi7483, 3 interactors
ComplexPortaliCPX-1442 SCF(COI1) ubiquitin ligase complex, variant CUL1-RBX1A-ASK15
CPX-1463 SCF(COI1) ubiquitin ligase complex, variant CUL1-RBX1B-ASK15
CPX-1485 SCF(COI1) ubiquitin ligase complex, variant CUL2-RBX1A-ASK15
CPX-1508 SCF(COI1) ubiquitin ligase complex, variant CUL2-RBX1B-ASK15
CPX-1528 SCF(TIR1) ubiquitin ligase complex, variant CUL1-RBX1A-ASK15
CPX-1549 SCF(TIR1) ubiquitin ligase complex, variant CUL1-RBX1B-ASK15
CPX-1571 SCF(TIR1) ubiquitin ligase complex, variant CUL2-RBX1A-ASK15
CPX-1592 SCF(TIR1) ubiquitin ligase complex, variant CUL2-RBX1B-ASK15
IntActiQ1PEL7, 5 interactors
STRINGi3702.AT3G25650.1

Proteomic databases

PaxDbiQ1PEL7

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT3G25650.1; AT3G25650.1; AT3G25650 [Q1PEL7-1]
GeneIDi822152
GrameneiAT3G25650.1; AT3G25650.1; AT3G25650 [Q1PEL7-1]
KEGGiath:AT3G25650

Organism-specific databases

AraportiAT3G25650
TAIRilocus:2102370 AT3G25650

Phylogenomic databases

eggNOGiKOG1724 Eukaryota
COG5201 LUCA
HOGENOMiHOG000172184
InParanoidiQ1PEL7
KOiK03094
OMAiFEIVANM
OrthoDBi1412723at2759
PhylomeDBiQ1PEL7

Enzyme and pathway databases

UniPathwayiUPA00143

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q1PEL7

Gene expression databases

ExpressionAtlasiQ1PEL7 baseline and differential
GenevisibleiQ1PEL7 AT

Family and domain databases

InterProiView protein in InterPro
IPR016897 SKP1
IPR001232 SKP1-like
IPR036296 SKP1-like_dim_sf
IPR011333 SKP1/BTB/POZ_sf
IPR016072 Skp1_comp_dimer
IPR016073 Skp1_comp_POZ
PfamiView protein in Pfam
PF01466 Skp1, 1 hit
PF03931 Skp1_POZ, 1 hit
PIRSFiPIRSF028729 E3_ubiquit_lig_SCF_Skp, 1 hit
SMARTiView protein in SMART
SM00512 Skp1, 1 hit
SUPFAMiSSF54695 SSF54695, 1 hit
SSF81382 SSF81382, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiASK15_ARATH
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q1PEL7
Secondary accession number(s): Q9LI78
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 26, 2009
Last sequence update: May 26, 2009
Last modified: May 8, 2019
This is version 87 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. SIMILARITY comments
    Index of protein domains and families
  3. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again