Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q1MX18 (INSC_HUMAN)

Entry version 110 (16 Oct 2019)
Sequence version 1 (30 May 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein inscuteable homolog

Gene

INSC

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May function as an adapter linking the Par3 complex to the GPSM1/GPSM2 complex (PubMed:16458856). Involved in spindle orientation during mitosis. May regulate cell proliferation and differentiation in the developing nervous system. May play a role in the asymmetric division of fibroblasts and participate in the process of stratification of the squamous epithelium (By similarity).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Neurogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein inscuteable homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:INSC
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:33116 INSC

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		610668 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q1MX18

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi78W → A: Abolishes interaction with GPSM2. 1 Publication1
Mutagenesisi89E → R: Strongly reduces interaction with GPSM2. Abolishes interaction with GPSM2 and GPSM1; when associated with D-97. 1 Publication1
Mutagenesisi97K → D: Abolishes interaction with GPSM2 and GPSM1; when associated with R-89. 1 Publication1

Organism-specific databases

Open Targets

More...OpenTargetsi		ENSG00000188487

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162392191

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q1MX18

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		INSC

Domain mapping of disease mutations (DMDM)

More...DMDMi		116248172

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002524051 – 579Protein inscuteable homologAdd BLAST579

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q1MX18

PeptideAtlas

More...PeptideAtlasi		Q1MX18

PRoteomics IDEntifications database

More...PRIDEi		Q1MX18

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		61231 [Q1MX18-1]
61232 [Q1MX18-2]
61233 [Q1MX18-3]
61234 [Q1MX18-4]
61235 [Q1MX18-5]
69

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q1MX18

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q1MX18

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is expressed in various tissues with stronger expression in liver, kidney and small intestine. Isoform 2 is abundantly expressed in small intestine and to a lower extent in lung and pancreas.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in fetal cochlea.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000188487 Expressed in 95 organ(s), highest expression level in tibia

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q1MX18 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q1MX18 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA039769

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ALS2CR19/PAR3-beta and F2RL2/PAR3 (PubMed:16458856).

Interacts with GPSM1/AGS3 and GPSM2/LGN (via TPR repeat region) (PubMed:16458856, PubMed:22074847).

Identified in a complex with GPSM2 and F2RL2 (PubMed:16458856).

2 Publications

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		132426, 1 interactor

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q1MX18

Protein interaction database and analysis system

More...IntActi		Q1MX18, 12 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000368872

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1579
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q1MX18

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni74 – 89Important for interaction with GPSM21 PublicationAdd BLAST16

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi576 – 579PDZ-binding4

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IHN9 Eukaryota
ENOG410XSNH LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00390000001511

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000060207

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q1MX18

Identification of Orthologs from Complete Genome Data

More...OMAi		VASICCV

Database of Orthologous Groups

More...OrthoDBi		569133at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q1MX18

TreeFam database of animal gene trees

More...TreeFami		TF323559

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.25.10.10, 1 hit
3.30.30.160, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR000225 Armadillo
IPR031938 INSC_LBD
IPR038205 INSC_LBD_sf
IPR039921 Inscuteable

The PANTHER Classification System

More...PANTHERi		PTHR21386 PTHR21386, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF16748 INSC_LBD, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00185 ARM, 3 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48371 SSF48371, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q1MX18-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRRPPGNGEA ASEGPGGWGL WGVQESRRLC CAGHDRCKQA LLQIGINMMA 
        60         70         80         90        100
LPGGRHLDSV TLPGQRLHLM QVDSVQRWME DLKLMTECEC MCVLQAKPIS 
       110        120        130        140        150
LEEDAQGDLI LAGGPGPGDP LQLLLKRGWV ISTELRRIGQ KLAQDRWARV 
       160        170        180        190        200
HSMSVRLTCH ARSMVSEYSA VSRNSLKEMG EIEKLLMEKC SELSAVTERC 
       210        220        230        240        250
LQVENEHVLK SMKACVSETL SMLGQHFGQL LELALTREVQ ALVRKIDASD 
       260        270        280        290        300
NIYTTESTTG NLFSLTQEGA PLCRIIAKEG GVVALFKVCR QDSFRCLYPQ 
       310        320        330        340        350
ALRTLASICC VEEGVHQLEK VDGVLCLADI LTDNSHSEAT RAEAAAVVAQ 
       360        370        380        390        400
VTSPHLPVTQ HLSSFLESME EIVTALVKLC QEASSGEVFL LASAALANIT 
       410        420        430        440        450
FFDTMACEML LQLNAIRVLL EACSDKQRVD TPYTRDQIVT ILANMSVLEQ 
       460        470        480        490        500
CASDIIQENG VQLIMGMLSE KPRSGTPAEV AACERVQQKA AVTLARLSRD 
       510        520        530        540        550
PDVAREAVRL SCMSRLIELC RSPSERNSSD AVLVACLAAL RRLAGVCPEG 
       560        570 
LQDSDFQQLV QPRLVDSFLL CSNMEESFV
Length:579
Mass (Da):63,469
Last modified:May 30, 2006 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7CD8D19409FC3266
GO
Isoform 2 (identifier: Q1MX18-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: Missing.

Show »
Length:532
Mass (Da):58,454
Checksum:i46C413794E504E42
GO
Isoform 3 (identifier: Q1MX18-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-203: Missing.
     204-238: ENEHVLKSMKACVSETLSMLGQHFGQLLELALTRE → MRREWEARMETHSPIWQNLLMRLDNCLALRLQSPL
     278-319: Missing.

Note: No experimental confirmation available.
Show »
Length:334
Mass (Da):36,669
Checksum:i1B97112A17E1ADE4
GO
Isoform 4 (identifier: Q1MX18-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: Missing.
     278-319: Missing.

Note: No experimental confirmation available.
Show »
Length:490
Mass (Da):53,774
Checksum:i00FB28A1F62B99FA
GO
Isoform 5 (identifier: Q1MX18-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: Missing.
     239-239: V → VQVESHSVTRLECSGAISAQCNLRLPGSSDSPASAS

Note: No experimental confirmation available.
Show »
Length:567
Mass (Da):61,981
Checksum:i33D225D70DCD9A67
GO
Isoform 6 (identifier: Q1MX18-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: Missing.
     539-579: ALRRLAGVCPEGLQDSDFQQLVQPRLVDSFLLCSNMEESFV → MGIQLQVKKTNISALLLWFLFWHIQGCSA

Note: No experimental confirmation available.
Show »
Length:520
Mass (Da):57,188
Checksum:i73DB667C8BEE3113
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MSI1A0A0A0MSI1_HUMAN
Protein inscuteable homolog
INSC
566Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti212M → T in BAE17134 (Ref. 2) Curated1
Sequence conflicti216V → M in BAE17135 (Ref. 2) Curated1
Sequence conflicti226H → R in BAE17133 (Ref. 2) Curated1
Sequence conflicti251N → D in BAE17134 (Ref. 2) Curated1
Sequence conflicti513M → T in BAE17135 (Ref. 2) Curated1
Sequence conflicti577 – 578SF → GS in BAE17136 (Ref. 2) Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051073333D → N. Corresponds to variant dbSNP:rs17507577Ensembl.1
Natural variantiVAR_027852450Q → R. Corresponds to variant dbSNP:rs7123855Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0209461 – 203Missing in isoform 3. 1 PublicationAdd BLAST203
Alternative sequenceiVSP_0209471 – 47Missing in isoform 2, isoform 4, isoform 5 and isoform 6. 3 PublicationsAdd BLAST47
Alternative sequenceiVSP_020948204 – 238ENEHV…ALTRE → MRREWEARMETHSPIWQNLL MRLDNCLALRLQSPL in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_020949239V → VQVESHSVTRLECSGAISAQ CNLRLPGSSDSPASAS in isoform 5. 1 Publication1
Alternative sequenceiVSP_020950278 – 319Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_054159539 – 579ALRRL…EESFV → MGIQLQVKKTNISALLLWFL FWHIQGCSA in isoform 6. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB236158 mRNA Translation: BAE93463.1
AB236159 mRNA Translation: BAE93464.1
AB231744 mRNA Translation: BAE46891.1
AB231745 mRNA Translation: BAE17133.1
AB231746 mRNA Translation: BAE17134.1
AB231747 mRNA Translation: BAE17135.1
AB231748 mRNA Translation: BAE17136.1
AC090744 Genomic DNA No translation available.
BC127700 mRNA Translation: AAI27701.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS41621.1 [Q1MX18-1]
CCDS41622.1 [Q1MX18-2]
CCDS60735.1 [Q1MX18-6]
CCDS60736.1 [Q1MX18-4]

NCBI Reference Sequences

More...RefSeqi		NP_001027024.3, NM_001031853.4 [Q1MX18-1]
NP_001036001.1, NM_001042536.2 [Q1MX18-2]
NP_001265242.1, NM_001278313.1 [Q1MX18-2]
NP_001265243.1, NM_001278314.1
NP_001265244.1, NM_001278315.1 [Q1MX18-6]
NP_001265245.1, NM_001278316.1 [Q1MX18-4]
XP_006718290.1, XM_006718227.3 [Q1MX18-2]
XP_011518388.1, XM_011520086.1 [Q1MX18-6]
XP_016873186.1, XM_017017697.1 [Q1MX18-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000379554; ENSP00000368872; ENSG00000188487 [Q1MX18-1]
ENST00000379556; ENSP00000368874; ENSG00000188487 [Q1MX18-2]
ENST00000525218; ENSP00000436113; ENSG00000188487 [Q1MX18-4]
ENST00000528567; ENSP00000435022; ENSG00000188487 [Q1MX18-6]
ENST00000530161; ENSP00000436194; ENSG00000188487 [Q1MX18-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		387755

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:387755

UCSC genome browser

More...UCSCi		uc001mly.5 human [Q1MX18-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB236158 mRNA Translation: BAE93463.1
AB236159 mRNA Translation: BAE93464.1
AB231744 mRNA Translation: BAE46891.1
AB231745 mRNA Translation: BAE17133.1
AB231746 mRNA Translation: BAE17134.1
AB231747 mRNA Translation: BAE17135.1
AB231748 mRNA Translation: BAE17136.1
AC090744 Genomic DNA No translation available.
BC127700 mRNA Translation: AAI27701.1
CCDSiCCDS41621.1 [Q1MX18-1]
CCDS41622.1 [Q1MX18-2]
CCDS60735.1 [Q1MX18-6]
CCDS60736.1 [Q1MX18-4]
RefSeqiNP_001027024.3, NM_001031853.4 [Q1MX18-1]
NP_001036001.1, NM_001042536.2 [Q1MX18-2]
NP_001265242.1, NM_001278313.1 [Q1MX18-2]
NP_001265243.1, NM_001278314.1
NP_001265244.1, NM_001278315.1 [Q1MX18-6]
NP_001265245.1, NM_001278316.1 [Q1MX18-4]
XP_006718290.1, XM_006718227.3 [Q1MX18-2]
XP_011518388.1, XM_011520086.1 [Q1MX18-6]
XP_016873186.1, XM_017017697.1 [Q1MX18-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3SF4X-ray2.60D/E/F70-116[»]
SMRiQ1MX18
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi132426, 1 interactor
CORUMiQ1MX18
IntActiQ1MX18, 12 interactors
STRINGi9606.ENSP00000368872

PTM databases

iPTMnetiQ1MX18
PhosphoSitePlusiQ1MX18

Polymorphism and mutation databases

BioMutaiINSC
DMDMi116248172

Proteomic databases

PaxDbiQ1MX18
PeptideAtlasiQ1MX18
PRIDEiQ1MX18
ProteomicsDBi61231 [Q1MX18-1]
61232 [Q1MX18-2]
61233 [Q1MX18-3]
61234 [Q1MX18-4]
61235 [Q1MX18-5]
69

Genome annotation databases

EnsembliENST00000379554; ENSP00000368872; ENSG00000188487 [Q1MX18-1]
ENST00000379556; ENSP00000368874; ENSG00000188487 [Q1MX18-2]
ENST00000525218; ENSP00000436113; ENSG00000188487 [Q1MX18-4]
ENST00000528567; ENSP00000435022; ENSG00000188487 [Q1MX18-6]
ENST00000530161; ENSP00000436194; ENSG00000188487 [Q1MX18-2]
GeneIDi387755
KEGGihsa:387755
UCSCiuc001mly.5 human [Q1MX18-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		387755

GeneCards: human genes, protein and diseases

More...GeneCardsi		INSC
HGNCiHGNC:33116 INSC
HPAiHPA039769
MIMi610668 gene
neXtProtiNX_Q1MX18
OpenTargetsiENSG00000188487
PharmGKBiPA162392191

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410IHN9 Eukaryota
ENOG410XSNH LUCA
GeneTreeiENSGT00390000001511
HOGENOMiHOG000060207
InParanoidiQ1MX18
OMAiVASICCV
OrthoDBi569133at2759
PhylomeDBiQ1MX18
TreeFamiTF323559

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		INSC human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		387755
PharosiQ1MX18

Protein Ontology

More...PROi		PR:Q1MX18

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000188487 Expressed in 95 organ(s), highest expression level in tibia
ExpressionAtlasiQ1MX18 baseline and differential
GenevisibleiQ1MX18 HS

Family and domain databases

Gene3Di1.25.10.10, 1 hit
3.30.30.160, 1 hit
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR000225 Armadillo
IPR031938 INSC_LBD
IPR038205 INSC_LBD_sf
IPR039921 Inscuteable
PANTHERiPTHR21386 PTHR21386, 1 hit
PfamiView protein in Pfam
PF16748 INSC_LBD, 1 hit
SMARTiView protein in SMART
SM00185 ARM, 3 hits
SUPFAMiSSF48371 SSF48371, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiINSC_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q1MX18
Secondary accession number(s): A0PJX5
, Q1MX19, Q3C1V6, Q4AC95, Q4AC96, Q4AC97, Q4AC98
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: May 30, 2006
Last modified: October 16, 2019
This is version 110 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again