Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 114 (11 Dec 2019)
Sequence version 4 (30 Nov 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Centrosome and spindle pole-associated protein 1

Gene

CSPP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in cell-cycle-dependent microtubule organization.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Centrosome and spindle pole-associated protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CSPP1
Synonyms:CSPP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000104218.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26193 CSPP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611654 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q1MSJ5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Joubert syndrome 21 (JBTS21)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder presenting with cerebellar ataxia, oculomotor apraxia, hypotonia, neonatal breathing abnormalities and psychomotor delay. Neuroradiologically, it is characterized by cerebellar vermian hypoplasia/aplasia, thickened and reoriented superior cerebellar peduncles, and an abnormally large interpeduncular fossa, giving the appearance of a molar tooth on transaxial slices (molar tooth sign). Additional variable features include retinal dystrophy, renal disease, liver fibrosis, and polydactyly.
Related information in OMIM

Keywords - Diseasei

Ciliopathy, Joubert syndrome

Organism-specific databases

DisGeNET

More...
DisGeNETi
79848

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
CSPP1

MalaCards human disease database

More...
MalaCardsi
CSPP1
MIMi615636 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000104218

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
475 Joubert syndrome
397715 Joubert syndrome with Jeune asphyxiating thoracic dystrophy
564 Meckel syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142672066

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q1MSJ5 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CSPP1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
313104301

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002934641 – 1256Centrosome and spindle pole-associated protein 1Add BLAST1256

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei244PhosphoserineCombined sources1
Modified residuei459PhosphoserineCombined sources1
Modified residuei527PhosphoserineCombined sources1
Modified residuei901PhosphoserineCombined sources1
Modified residuei920PhosphoserineCombined sources1
Modified residuei966PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated. Phosphorylation increases in colcemide-treated cells.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q1MSJ5

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q1MSJ5

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q1MSJ5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q1MSJ5

PeptideAtlas

More...
PeptideAtlasi
Q1MSJ5

PRoteomics IDEntifications database

More...
PRIDEi
Q1MSJ5

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
61228 [Q1MSJ5-3]
61229 [Q1MSJ5-1]
61230 [Q1MSJ5-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q1MSJ5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q1MSJ5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in adult and fetal brain with enrichment in the cerebellum. Detected in testis.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Isoform 1 expression increases throughout the cell cycle and peaks in G2/M phase. Isoform 2 expression is highest in G1 phase and decreases thereafter.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000104218 Expressed in 219 organ(s), highest expression level in bronchial epithelial cell

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q1MSJ5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q1MSJ5 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA056174

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PLEKHG6.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122939, 63 interactors

Protein interaction database and analysis system

More...
IntActi
Q1MSJ5, 56 interactors

Molecular INTeraction database

More...
MINTi
Q1MSJ5

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000262210

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q1MSJ5 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q1MSJ5

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili38 – 62Sequence analysisAdd BLAST25
Coiled coili114 – 135Sequence analysisAdd BLAST22
Coiled coili244 – 270Sequence analysisAdd BLAST27
Coiled coili417 – 449Sequence analysisAdd BLAST33
Coiled coili625 – 669Sequence analysisAdd BLAST45
Coiled coili925 – 964Sequence analysisAdd BLAST40

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi478 – 541Pro-richAdd BLAST64
Compositional biasi672 – 677Poly-Gly6
Compositional biasi779 – 855Glu-richAdd BLAST77

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IFHQ Eukaryota
ENOG4111FD8 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000015084

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000060302

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q1MSJ5

KEGG Orthology (KO)

More...
KOi
K16771

Identification of Orthologs from Complete Genome Data

More...
OMAi
PEICKMA

Database of Orthologous Groups

More...
OrthoDBi
1439603at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q1MSJ5

TreeFam database of animal gene trees

More...
TreeFami
TF335475

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026708 CSPP1

The PANTHER Classification System

More...
PANTHERi
PTHR21616 PTHR21616, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: Q1MSJ5-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLFPLQVAAV TSSVRDDPLE HCVSPRTRAR SPEICKMADN LDEFIEEQKA
60 70 80 90 100
RLAEDKAELE SDPPYMEMKG KLSAKLSENS KILISMAKEN IPPNSQQTRG
110 120 130 140 150
SLGIDYGLSL PLGEDYERKK HKLKEELRQD YRRYLTQGIT QGKRKKNFLS
160 170 180 190 200
TSETDPSTLG VSLPIGERLS AKERLKLERN KEYNQFLRGK EESSEKFRQV
210 220 230 240 250
EKSTEPKSQR NKKPIGQVKP DLTSQIQTSC ENSEGPRKDV LTPSEAYEEL
260 270 280 290 300
LNQRRLEEDR YRQLDDEIEL RNRRIIKKAN EEVGISNLKH QRFASKAGIP
310 320 330 340 350
DRRFHRFNED RVFDRRYHRP DQDPEVSEEM DERFRYESDF DRRLSRVYTN
360 370 380 390 400
DRMHRNKRGN MPPMEHDGDV IEQSNIRISS AENKSAPDNE TSKSANQDTC
410 420 430 440 450
SPFAGMLFGG EDRELIQRRK EKYRLELLEQ MAEQQRNKRR EKDLELRVAA
460 470 480 490 500
SGAQDPEKSP DRLKQFSVAP RHFEEMIPPE RPRIAFQTPL PPLSAPSVPP
510 520 530 540 550
IPSVHPVPSQ NEDLRSGLSS ALGEMVSPRI APLPPPPLLP PLATNYRTPY
560 570 580 590 600
DDAYYFYGSR NTFDPSLAYY GSGMMGVQPA AYVSAPVTHQ LAQPVVNTVG
610 620 630 640 650
QNELKITSDQ VINSGLIFED KPKPSKQSLQ SYQEALQQQI REREERRKKE
660 670 680 690 700
REEKEEYEAK LEAEMRTYNP WGKGGGGAPL RDAKGNLITD LNRMHRQNID
710 720 730 740 750
AYHNPDARTY EDKRAVVSLD PNLATSNAEN LEDAANKSSG HMQTQSSPFA
760 770 780 790 800
RGNVFGEPPT ELQIKQQELY KNFLRFQIEE KKQREEAERE RLRIAEEKEE
810 820 830 840 850
RRLAEQRARI QQEYEEEQEK KREKEEEQRL KNEEHIRLAE ERQKEAERKK
860 870 880 890 900
KEEEEKYNLQ LQHYCERDNL IGEETKHMRQ PSPIVPALQN KIASKLQRPP
910 920 930 940 950
SVDSIIRSFI HESSMSRAQS PPVPARKNQL RAEEEKKNVI MELSEMRKQL
960 970 980 990 1000
RSEERRLQER LLHMDSDDEI PIRKKERNPM DIFDMARHRL QAPVRRQSPK
1010 1020 1030 1040 1050
GLDAATFQNV HDFNELKDRD SETRVDLKFM YLDPPRDHHT LEIQQQALLR
1060 1070 1080 1090 1100
EQQKRLNRIK MQEGAKVDLD AIPSAKVREQ RMPRDDTSDF LKNSLLESDS
1110 1120 1130 1140 1150
AFIGAYGETY PAIEDDVLPP PSQLPSARER RRNKWKGLDI DSSRPNVAPD
1160 1170 1180 1190 1200
GLSLKSISSV NVDELRVRNE ERMRRLNEFH NKPINTDDES SLVDPDDIMK
1210 1220 1230 1240 1250
HIGDDGSNSV ATEPWLRPGT SETLKRFMAE QLNQEQQQIP GKPGTFTWQG

LSTAHG
Length:1,256
Mass (Da):145,522
Last modified:November 30, 2010 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i81AA10E05F7A5A71
GO
Isoform 1 (identifier: Q1MSJ5-1) [UniParc]FASTAAdd to basket
Also known as: CSPP-L

The sequence of this isoform differs from the canonical sequence as follows:
     138-172: Missing.

Show »
Length:1,221
Mass (Da):141,823
Checksum:iB95D46B69E7DC5CB
GO
Isoform 2 (identifier: Q1MSJ5-2) [UniParc]FASTAAdd to basket
Also known as: CSPP, CSPP-S

The sequence of this isoform differs from the canonical sequence as follows:
     1-329: Missing.
     689-740: TDLNRMHRQNIDAYHNPDARTYEDKRAVVSLDPNLATSNAENLEDAANKSSG → S

Show »
Length:876
Mass (Da):101,555
Checksum:iAC694546724EE0C5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F2Z2M5F2Z2M5_HUMAN
Centrosome and spindle pole-associa...
CSPP1
404Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RI67E5RI67_HUMAN
Centrosome and spindle pole-associa...
CSPP1
154Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RGA5E5RGA5_HUMAN
Centrosome and spindle pole-associa...
CSPP1
66Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH22867 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti855E → G in CAE47426 (PubMed:15580290).Curated1
Sequence conflicti855E → G in CAJ42307 (PubMed:16826565).Curated1
Sequence conflicti860Q → E in AAH22867 (PubMed:15489334).Curated1
Sequence conflicti905I → T in CAE47426 (PubMed:15580290).Curated1
Sequence conflicti905I → T in CAJ42307 (PubMed:16826565).Curated1
Sequence conflicti955R → K in CAE47426 (PubMed:15580290).Curated1
Sequence conflicti955R → K in CAJ42307 (PubMed:16826565).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_033045907R → H1 PublicationCorresponds to variant dbSNP:rs16933182Ensembl.1
Natural variantiVAR_0470141135W → R1 PublicationCorresponds to variant dbSNP:rs1808140Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0264751 – 329Missing in isoform 2. 1 PublicationAdd BLAST329
Alternative sequenceiVSP_040072138 – 172Missing in isoform 1. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_026476689 – 740TDLNR…NKSSG → S in isoform 2. 1 PublicationAdd BLAST52

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ583433 mRNA Translation: CAE47426.1
AM156947 mRNA Translation: CAJ42307.1
AC087359 Genomic DNA No translation available.
AC109335 Genomic DNA No translation available.
AK127108 mRNA No translation available.
BC022867 mRNA Translation: AAH22867.1 Different initiation.
BC152993 mRNA Translation: AAI52994.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43744.1 [Q1MSJ5-1]
CCDS78344.1 [Q1MSJ5-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001278268.1, NM_001291339.1 [Q1MSJ5-2]
NP_079066.5, NM_024790.6 [Q1MSJ5-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000262210; ENSP00000262210; ENSG00000104218 [Q1MSJ5-1]
ENST00000519668; ENSP00000430092; ENSG00000104218 [Q1MSJ5-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79848

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79848

UCSC genome browser

More...
UCSCi
uc003xxj.4 human [Q1MSJ5-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ583433 mRNA Translation: CAE47426.1
AM156947 mRNA Translation: CAJ42307.1
AC087359 Genomic DNA No translation available.
AC109335 Genomic DNA No translation available.
AK127108 mRNA No translation available.
BC022867 mRNA Translation: AAH22867.1 Different initiation.
BC152993 mRNA Translation: AAI52994.1
CCDSiCCDS43744.1 [Q1MSJ5-1]
CCDS78344.1 [Q1MSJ5-2]
RefSeqiNP_001278268.1, NM_001291339.1 [Q1MSJ5-2]
NP_079066.5, NM_024790.6 [Q1MSJ5-1]

3D structure databases

SMRiQ1MSJ5
ModBaseiSearch...

Protein-protein interaction databases

BioGridi122939, 63 interactors
IntActiQ1MSJ5, 56 interactors
MINTiQ1MSJ5
STRINGi9606.ENSP00000262210

PTM databases

iPTMnetiQ1MSJ5
PhosphoSitePlusiQ1MSJ5

Polymorphism and mutation databases

BioMutaiCSPP1
DMDMi313104301

Proteomic databases

EPDiQ1MSJ5
jPOSTiQ1MSJ5
MassIVEiQ1MSJ5
PaxDbiQ1MSJ5
PeptideAtlasiQ1MSJ5
PRIDEiQ1MSJ5
ProteomicsDBi61228 [Q1MSJ5-3]
61229 [Q1MSJ5-1]
61230 [Q1MSJ5-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
79848

Genome annotation databases

EnsembliENST00000262210; ENSP00000262210; ENSG00000104218 [Q1MSJ5-1]
ENST00000519668; ENSP00000430092; ENSG00000104218 [Q1MSJ5-2]
GeneIDi79848
KEGGihsa:79848
UCSCiuc003xxj.4 human [Q1MSJ5-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79848
DisGeNETi79848
EuPathDBiHostDB:ENSG00000104218.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CSPP1
GeneReviewsiCSPP1
HGNCiHGNC:26193 CSPP1
HPAiHPA056174
MalaCardsiCSPP1
MIMi611654 gene
615636 phenotype
neXtProtiNX_Q1MSJ5
OpenTargetsiENSG00000104218
Orphaneti475 Joubert syndrome
397715 Joubert syndrome with Jeune asphyxiating thoracic dystrophy
564 Meckel syndrome
PharmGKBiPA142672066

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IFHQ Eukaryota
ENOG4111FD8 LUCA
GeneTreeiENSGT00390000015084
HOGENOMiHOG000060302
InParanoidiQ1MSJ5
KOiK16771
OMAiPEICKMA
OrthoDBi1439603at2759
PhylomeDBiQ1MSJ5
TreeFamiTF335475

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CSPP1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79848
PharosiQ1MSJ5 Tbio

Protein Ontology

More...
PROi
PR:Q1MSJ5
RNActiQ1MSJ5 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000104218 Expressed in 219 organ(s), highest expression level in bronchial epithelial cell
ExpressionAtlasiQ1MSJ5 baseline and differential
GenevisibleiQ1MSJ5 HS

Family and domain databases

InterProiView protein in InterPro
IPR026708 CSPP1
PANTHERiPTHR21616 PTHR21616, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCSPP1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q1MSJ5
Secondary accession number(s): A6ND63, Q70F00, Q8TBC1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: November 30, 2010
Last modified: December 11, 2019
This is version 114 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again