Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).
Entry version 158 (07 Apr 2021)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Add a publicationFeedback
Protein

Intermediate filament protein ifb-1

Gene

ifb-1

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cytoplasmic intermediate filaments provide mechanical strength to cells. Essential protein, involved in attachment structures in epidermal cells that connect muscles to the external cuticle. Required in morphogenesis and epidermal integrity. Probable component of embryonic epidermal attachment structures. Functions in larval muscle attachment independently of ifa-2.3 Publications

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Intermediate filament protein ifb-1
Alternative name(s):
Cel IF B1
Intermediate filament protein B1
Short name:
IF-B1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ifb-1
ORF Names:F10C1.2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome II

Organism-specific databases

WormBase

More...
WormBasei
F10C1.2a ; CE02618 ; WBGene00002053 ; ifb-1
F10C1.2b ; CE02619 ; WBGene00002053 ; ifb-1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Intermediate filament

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

RNAi-mediated knockdown results in 79% embryonic lethality and 19% larval lethality. Abnormal localization of epidermal structural protein pat-12 during embryogenesis.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000638381 – 589Intermediate filament protein ifb-1Add BLAST589

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q19289

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q19289

PeptideAtlas

More...
PeptideAtlasi
Q19289

2D gel databases

The World-2DPAGE database

More...
World-2DPAGEi
0020:Q19289

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in epidermal cells. Expressed in amphid sensory neurons, the excretory cells, the vulva, the uterus, the rectum and some neurons of the tail. Isoform a and isoform b display a similar pattern of expression. Isoform a is predominant in pharyngeal tonofilaments.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00002053, Expressed in multi-cellular organism and 5 other tissues

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms some heteropolymeric filaments with ifa-1, ifa-2, ifa-3 and probably ifa-4.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
39317, 20 interactors

Database of interacting proteins

More...
DIPi
DIP-26309N

Protein interaction database and analysis system

More...
IntActi
Q19289, 9 interactors

STRING: functional protein association networks

More...
STRINGi
6239.F10C1.2b

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q19289

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini81 – 433IF rodPROSITE-ProRule annotationAdd BLAST353
Domaini466 – 584LTDPROSITE-ProRule annotationAdd BLAST119

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni8 – 84HeadAdd BLAST77
Regioni85 – 116Coil 1AAdd BLAST32
Regioni117 – 130Linker 1Add BLAST14
Regioni131 – 268Coil 1BAdd BLAST138
Regioni269 – 285Linker 12Add BLAST17
Regioni286 – 433Coil 2Add BLAST148
Regioni434 – 588TailAdd BLAST155

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the intermediate filament family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0977, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q19289

Identification of Orthologs from Complete Genome Data

More...
OMAi
RMREECQ

Database of Orthologous Groups

More...
OrthoDBi
701388at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q19289

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.5.1160, 2 hits
2.60.40.1260, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR018039, IF_conserved
IPR039008, IF_rod_dom
IPR042180, IF_rod_dom_coil1B
IPR016451, Intermed_filament_ifa/ifb
IPR001322, Lamin_tail_dom
IPR036415, Lamin_tail_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00038, Filament, 1 hit
PF00932, LTD, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF005546, Intermed_filamnt_Ifb-2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01391, Filament, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF74853, SSF74853, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00226, IF_ROD_1, 1 hit
PS51842, IF_ROD_2, 1 hit
PS51841, LTD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform a (identifier: Q19289-1) [UniParc]FASTAAdd to basket
Also known as: B1b, IFB-1B

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSHKESSEY EMQYRSTIQP RTAVRSQSRQ SGNYVSGGNG AGSGGRVLKM
60 70 80 90 100
VTEMGSATVG GISPALSANA AKSFLEATDK EKKTLQGLND RLGNYIDRVK
110 120 130 140 150
KLEEQNRKLV ADLDELRGKW GKDTSEIKIK YSESLSTARK DIDDAARRKA
160 170 180 190 200
EVDVKVARHR DDLAEYRSRY EDIQQRRESD REKISQWTNA IADAQSEVEM
210 220 230 240 250
LRARFKQLTD EEKRVTADNS RIWEELQKAR SDLDDETIGR IDFQNQVQTL
260 270 280 290 300
MEELEFLRRV HEQEVKELQA LLAQAPADTR EFFKNELALA IRDIKDEYDI
310 320 330 340 350
IAKQGKQDME SWYKLKVSEV QGSANRANME STYQRDEVKR MRDNIGDLRG
360 370 380 390 400
KLGDLENKNS LLEKEVQNLN YQLTDDQRQY EAALNDRDAT LRRMREECQT
410 420 430 440 450
LVAELQALLD TKQMLDAEIA IYRKMLEGEE TRVGLTQMVE QAVKTHSLQQ
460 470 480 490 500
QENTDSTRSV RGEVSTKTTF QRSAKGNVTI SECDPNGKFI KLENSHRNKD
510 520 530 540 550
ENVGEHKIRR KLDGRREIVY SIPANVVIKP GKNLTIYARD QGGINNPPES
560 570 580
LVFDGENTWG IGANVVTSLV NKDGEERATH TQKTIQSGQ
Length:589
Mass (Da):67,149
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC4B6231224ED9AB0
GO
Isoform b (identifier: Q19289-2) [UniParc]FASTAAdd to basket
Also known as: B1a IFB-1A

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: MSSHKESSEYEMQYRSTIQPRTAVRSQSRQSGNYVSGGNGAG → MEAESAPQAPM

Show »
Length:558
Mass (Da):63,700
Checksum:iA25DFFAE9DAD7AAF
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAA50178 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0101471 – 42MSSHK…GNGAG → MEAESAPQAPM in isoform b. CuratedAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X70830 Genomic DNA Translation: CAA50178.1 Sequence problems.
FO080600 Genomic DNA Translation: CCD65029.1
FO080600 Genomic DNA Translation: CCD65030.1

Protein sequence database of the Protein Information Resource

More...
PIRi
D88163
T16018, S46326

NCBI Reference Sequences

More...
RefSeqi
NP_495136.1, NM_062735.4
NP_495137.1, NM_062736.3 [Q19289-2]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
F10C1.2a.1; F10C1.2a.1; WBGene00002053 [Q19289-2]
F10C1.2a.2; F10C1.2a.2; WBGene00002053 [Q19289-2]
F10C1.2b.1; F10C1.2b.1; WBGene00002053 [Q19289-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
173976

UCSC genome browser

More...
UCSCi
F10C1.2b, c. elegans [Q19289-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X70830 Genomic DNA Translation: CAA50178.1 Sequence problems.
FO080600 Genomic DNA Translation: CCD65029.1
FO080600 Genomic DNA Translation: CCD65030.1
PIRiD88163
T16018, S46326
RefSeqiNP_495136.1, NM_062735.4
NP_495137.1, NM_062736.3 [Q19289-2]

3D structure databases

SMRiQ19289
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi39317, 20 interactors
DIPiDIP-26309N
IntActiQ19289, 9 interactors
STRINGi6239.F10C1.2b

2D gel databases

World-2DPAGEi0020:Q19289

Proteomic databases

EPDiQ19289
PaxDbiQ19289
PeptideAtlasiQ19289

Genome annotation databases

EnsemblMetazoaiF10C1.2a.1; F10C1.2a.1; WBGene00002053 [Q19289-2]
F10C1.2a.2; F10C1.2a.2; WBGene00002053 [Q19289-2]
F10C1.2b.1; F10C1.2b.1; WBGene00002053 [Q19289-1]
GeneIDi173976
UCSCiF10C1.2b, c. elegans [Q19289-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
173976
WormBaseiF10C1.2a ; CE02618 ; WBGene00002053 ; ifb-1
F10C1.2b ; CE02619 ; WBGene00002053 ; ifb-1

Phylogenomic databases

eggNOGiKOG0977, Eukaryota
InParanoidiQ19289
OMAiRMREECQ
OrthoDBi701388at2759
PhylomeDBiQ19289

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q19289

Gene expression databases

BgeeiWBGene00002053, Expressed in multi-cellular organism and 5 other tissues

Family and domain databases

Gene3Di1.20.5.1160, 2 hits
2.60.40.1260, 1 hit
InterProiView protein in InterPro
IPR018039, IF_conserved
IPR039008, IF_rod_dom
IPR042180, IF_rod_dom_coil1B
IPR016451, Intermed_filament_ifa/ifb
IPR001322, Lamin_tail_dom
IPR036415, Lamin_tail_dom_sf
PfamiView protein in Pfam
PF00038, Filament, 1 hit
PF00932, LTD, 1 hit
PIRSFiPIRSF005546, Intermed_filamnt_Ifb-2, 1 hit
SMARTiView protein in SMART
SM01391, Filament, 1 hit
SUPFAMiSSF74853, SSF74853, 1 hit
PROSITEiView protein in PROSITE
PS00226, IF_ROD_1, 1 hit
PS51842, IF_ROD_2, 1 hit
PS51841, LTD, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiIFB1_CAEEL
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q19289
Secondary accession number(s): Q19290, Q21063
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: November 1, 1996
Last modified: April 7, 2021
This is version 158 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again