Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 113 (07 Oct 2020)
Sequence version 2 (20 May 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Lymphocyte antigen 6K

Gene

LY6K

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for sperm migration into the oviduct and male fertility by controlling binding of sperm to zona pellucida (By similarity). May play a role in cell growth (PubMed:18089789).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q17RY6

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-163125, Post-translational modification: synthesis of GPI-anchored proteins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Lymphocyte antigen 6KCurated
Short name:
Ly-6K1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LY6KImported
Synonyms:CO161 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000160886.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24225, LY6K

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615093, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q17RY6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoplasmic vesicle, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
54742

Open Targets

More...
OpenTargetsi
ENSG00000160886

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134987940

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q17RY6, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LY6K

Domain mapping of disease mutations (DMDM)

More...
DMDMi
189028864

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 17Sequence analysisAdd BLAST17
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000033708418 – 138Lymphocyte antigen 6KAdd BLAST121
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_0000337085139 – 165Removed in mature formSequence analysisAdd BLAST27

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi20N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi138GPI-anchor amidated glycineSequence analysis1

Keywords - PTMi

Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q17RY6

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q17RY6

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q17RY6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q17RY6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q17RY6

PeptideAtlas

More...
PeptideAtlasi
Q17RY6

PRoteomics IDEntifications database

More...
PRIDEi
Q17RY6

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
32227
61174 [Q17RY6-1]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q17RY6, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q17RY6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q17RY6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Specifically expressed in testis (at protein level).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000160886, Expressed in vagina and 145 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q17RY6, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q17RY6, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000160886, Tissue enhanced (testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with TEX101.

By similarity

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000292430

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q17RY6, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini47 – 141UPAR/Ly6Add BLAST95

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502TDVS, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159966

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_105666_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q17RY6

Identification of Orthologs from Complete Genome Data

More...
OMAi
YCNLQGP

Database of Orthologous Groups

More...
OrthoDBi
1586315at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q17RY6

TreeFam database of animal gene trees

More...
TreeFami
TF336908

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q17RY6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALLALLLVV ALPRVWTDAN LTARQRDPED SQRTDEGDNR VWCHVCEREN
60 70 80 90 100
TFECQNPRRC KWTEPYCVIA AVKIFPRFFM VAKQCSAGCA AMERPKPEEK
110 120 130 140 150
RFLLEEPMPF FYLKCCKIRY CNLEGPPINS SVFKEYAGSM GESCGGLWLA
160
ILLLLASIAA GLSLS
Length:165
Mass (Da):18,673
Last modified:May 20, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBA75B436BE91363D
GO
Isoform 2 (identifier: Q17RY6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     73-105: KIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLE → TVLRWLCSDGETQARGEAVSPGRAHALLLPQVL
     106-165: Missing.

Show »
Length:105
Mass (Da):11,902
Checksum:iD2FEF4616469798C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E5RGJ8E5RGJ8_HUMAN
Lymphocyte antigen 6K
LY6K
100Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YB07H0YB07_HUMAN
Lymphocyte antigen 6K
LY6K
85Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH01291 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAI17143 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAI17145 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAA04692 differs from that shown. Reason: Frameshift.Curated
The sequence CAA04692 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence EAW82311 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti29E → Q in CAA04692 (Ref. 1) Curated1
Sequence conflicti41V → A in CAA04692 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04560273 – 105KIFPR…RFLLE → TVLRWLCSDGETQARGEAVS PGRAHALLLPQVL in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_045603106 – 165Missing in isoform 2. 1 PublicationAdd BLAST60

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ001348 mRNA Translation: CAA04692.1 Sequence problems.
AC108002 Genomic DNA No translation available.
CH471162 Genomic DNA Translation: EAW82311.1 Different initiation.
BC001291 mRNA Translation: AAH01291.2 Different initiation.
BC117142 mRNA Translation: AAI17143.1 Different initiation.
BC117144 mRNA Translation: AAI17145.1 Different initiation.
AI740834 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS59114.1 [Q17RY6-2]
CCDS6385.2 [Q17RY6-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001153826.1, NM_001160354.1
NP_001153827.1, NM_001160355.1 [Q17RY6-2]
NP_059997.3, NM_017527.3 [Q17RY6-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000292430; ENSP00000292430; ENSG00000160886 [Q17RY6-1]
ENST00000519387; ENSP00000429695; ENSG00000160886 [Q17RY6-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
54742

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:54742

UCSC genome browser

More...
UCSCi
uc011ljv.3, human [Q17RY6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ001348 mRNA Translation: CAA04692.1 Sequence problems.
AC108002 Genomic DNA No translation available.
CH471162 Genomic DNA Translation: EAW82311.1 Different initiation.
BC001291 mRNA Translation: AAH01291.2 Different initiation.
BC117142 mRNA Translation: AAI17143.1 Different initiation.
BC117144 mRNA Translation: AAI17145.1 Different initiation.
AI740834 mRNA No translation available.
CCDSiCCDS59114.1 [Q17RY6-2]
CCDS6385.2 [Q17RY6-1]
RefSeqiNP_001153826.1, NM_001160354.1
NP_001153827.1, NM_001160355.1 [Q17RY6-2]
NP_059997.3, NM_017527.3 [Q17RY6-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi9606.ENSP00000292430

PTM databases

GlyGeniQ17RY6, 1 site
iPTMnetiQ17RY6
PhosphoSitePlusiQ17RY6

Polymorphism and mutation databases

BioMutaiLY6K
DMDMi189028864

Proteomic databases

EPDiQ17RY6
jPOSTiQ17RY6
MassIVEiQ17RY6
MaxQBiQ17RY6
PaxDbiQ17RY6
PeptideAtlasiQ17RY6
PRIDEiQ17RY6
ProteomicsDBi32227
61174 [Q17RY6-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
3032, 103 antibodies

The CPTC Antibody Portal

More...
CPTCi
Q17RY6, 3 antibodies

Genome annotation databases

EnsembliENST00000292430; ENSP00000292430; ENSG00000160886 [Q17RY6-1]
ENST00000519387; ENSP00000429695; ENSG00000160886 [Q17RY6-2]
GeneIDi54742
KEGGihsa:54742
UCSCiuc011ljv.3, human [Q17RY6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
54742
DisGeNETi54742
EuPathDBiHostDB:ENSG00000160886.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LY6K
HGNCiHGNC:24225, LY6K
HPAiENSG00000160886, Tissue enhanced (testis)
MIMi615093, gene
neXtProtiNX_Q17RY6
OpenTargetsiENSG00000160886
PharmGKBiPA134987940

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502TDVS, Eukaryota
GeneTreeiENSGT00940000159966
HOGENOMiCLU_105666_0_0_1
InParanoidiQ17RY6
OMAiYCNLQGP
OrthoDBi1586315at2759
PhylomeDBiQ17RY6
TreeFamiTF336908

Enzyme and pathway databases

PathwayCommonsiQ17RY6
ReactomeiR-HSA-163125, Post-translational modification: synthesis of GPI-anchored proteins

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
54742, 3 hits in 871 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
54742
PharosiQ17RY6, Tbio

Protein Ontology

More...
PROi
PR:Q17RY6
RNActiQ17RY6, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000160886, Expressed in vagina and 145 other tissues
ExpressionAtlasiQ17RY6, baseline and differential
GenevisibleiQ17RY6, HS

Family and domain databases

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLY6K_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q17RY6
Secondary accession number(s): G3V116, O15227, Q9BVD7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: October 7, 2020
This is version 113 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again