Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 127 (10 Feb 2021)
Sequence version 1 (25 Jul 2006)
Previous versions | rss
Add a publicationFeedback
Protein

Putative deoxyribonuclease TATDN3

Gene

TATDN3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Putative deoxyribonuclease.

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

a divalent metal cationNote: Binds 2 divalent metal cations per subunit.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi12Divalent metal cation 11
Metal bindingi14Divalent metal cation 11
Metal bindingi107Divalent metal cation 11
Metal bindingi107Divalent metal cation 21
Metal bindingi147Divalent metal cation 21
Metal bindingi170Divalent metal cation 21
Metal bindingi218Divalent metal cation 11

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Nuclease
LigandMetal-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q17R31

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Putative deoxyribonuclease TATDN3 (EC:3.1.21.-)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TATDN3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:27010, TATDN3

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q17R31

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000203705.10

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000203705

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142670831

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q17R31, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TATDN3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
121948822

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003135951 – 274Putative deoxyribonuclease TATDN3Add BLAST274

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q17R31

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q17R31

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q17R31

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q17R31

PeptideAtlas

More...
PeptideAtlasi
Q17R31

PRoteomics IDEntifications database

More...
PRIDEi
Q17R31

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
21114
22414
32260
61133 [Q17R31-1]
61134 [Q17R31-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q17R31

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q17R31

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000203705, Expressed in corpus callosum and 220 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q17R31, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q17R31, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000203705, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
126118, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q17R31, 4 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000431376

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q17R31, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1274
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q17R31

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3020, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00720000108846

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_031506_5_3_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q17R31

Identification of Orthologs from Complete Genome Data

More...
OMAi
CHLDAGE

Database of Orthologous Groups

More...
OrthoDBi
988732at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q17R31

Family and domain databases

Conserved Domains Database

More...
CDDi
cd01310, TatD_DNAse, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR032466, Metal_Hydrolase
IPR001130, TatD_family

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01026, TatD_DNase, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF005902, DNase_TatD, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51556, SSF51556, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q17R31-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRAAGVGLVD CHCHLSAPDF DRDLDDVLEK AKKANVVALV AVAEHSGEFE
60 70 80 90 100
KIMQLSERYN GFVLPCLGVH PVQGLPPEDQ RSVTLKDLDV ALPIIENYKD
110 120 130 140 150
RLLAIGEVGL DFSPRFAGTG EQKEEQRQVL IRQIQLAKRL NLPVNVHSRS
160 170 180 190 200
AGRPTINLLQ EQGAEKVLLH AFDGRPSVAM EGVRAGYFFS IPPSIIRSGQ
210 220 230 240 250
KQKLVKQLPL TSICLETDSP ALGPEKQVRN EPWNISISAE YIAQVKGISV
260 270
EEVIEVTTQN ALKLFPKLRH LLQK
Length:274
Mass (Da):30,333
Last modified:July 25, 2006 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD2428A5666E164A5
GO
Isoform 2 (identifier: Q17R31-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     201-201: Missing.

Show »
Length:273
Mass (Da):30,205
Checksum:i8E68621787CB18E9
GO
Isoform 3 (identifier: Q17R31-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     200-200: Q → QLLSLFSK

Show »
Length:281
Mass (Da):31,122
Checksum:i7EF47D4C411BE35E
GO
Isoform 4 (identifier: Q17R31-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-107: Missing.

Show »
Length:253
Mass (Da):27,980
Checksum:iC8474597AACFED9D
GO
Isoform 5 (identifier: Q17R31-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     200-200: Q → QLLSLFSK
     228-274: VRNEPWNISISAEYIAQVKGISVEEVIEVTTQNALKLFPKLRHLLQK → QNILPR

Show »
Length:240
Mass (Da):26,458
Checksum:iE78E1CD69060E04C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PP81E9PP81_HUMAN
Putative deoxyribonuclease TATDN3
TATDN3
191Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PPF0E9PPF0_HUMAN
Putative deoxyribonuclease TATDN3
TATDN3
61Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PQP8E9PQP8_HUMAN
Putative deoxyribonuclease TATDN3
TATDN3
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PRA1E9PRA1_HUMAN
Putative deoxyribonuclease TATDN3
TATDN3
161Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YCC7H0YCC7_HUMAN
Putative deoxyribonuclease TATDN3
TATDN3
144Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YD82H0YD82_HUMAN
Putative deoxyribonuclease TATDN3
TATDN3
60Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YCN0H0YCN0_HUMAN
Putative deoxyribonuclease TATDN3
TATDN3
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
U3KQ29U3KQ29_HUMAN
Putative deoxyribonuclease TATDN3
TATDN3
31Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH48115 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti86K → R in BAH11457 (PubMed:14702039).Curated1
Sequence conflicti171A → T in BAH11457 (PubMed:14702039).Curated1
Sequence conflicti231E → G in BAH14214 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04526387 – 107Missing in isoform 4. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_044448200Q → QLLSLFSK in isoform 3 and isoform 5. 1 Publication1
Alternative sequenceiVSP_030048201Missing in isoform 2. 1 Publication1
Alternative sequenceiVSP_045742228 – 274VRNEP…HLLQK → QNILPR in isoform 5. CuratedAdd BLAST47

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK293129 mRNA Translation: BAH11457.1
AK304557 mRNA Translation: BAH14214.1
AC104333 Genomic DNA No translation available.
CH471100 Genomic DNA Translation: EAW93376.1
CH471100 Genomic DNA Translation: EAW93377.1
CH471100 Genomic DNA Translation: EAW93378.1
BC048115 mRNA Translation: AAH48115.1 Different initiation.
BC113638 mRNA Translation: AAI13639.1
BC117485 mRNA Translation: AAI17486.1
BC143956 mRNA Translation: AAI43957.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31019.1 [Q17R31-1]
CCDS41465.1 [Q17R31-2]
CCDS53475.1 [Q17R31-3]
CCDS53476.1 [Q17R31-5]
CCDS53477.1 [Q17R31-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001036017.1, NM_001042552.2 [Q17R31-1]
NP_001036018.1, NM_001042553.2 [Q17R31-2]
NP_001139641.1, NM_001146169.1 [Q17R31-5]
NP_001139642.1, NM_001146170.1 [Q17R31-4]
NP_001139643.1, NM_001146171.1 [Q17R31-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000366973; ENSP00000355940; ENSG00000203705 [Q17R31-2]
ENST00000366974; ENSP00000355941; ENSG00000203705 [Q17R31-1]
ENST00000526641; ENSP00000434801; ENSG00000203705 [Q17R31-4]
ENST00000531963; ENSP00000433755; ENSG00000203705 [Q17R31-5]
ENST00000532324; ENSP00000431376; ENSG00000203705 [Q17R31-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
128387

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:128387

UCSC genome browser

More...
UCSCi
uc001hjo.3, human [Q17R31-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK293129 mRNA Translation: BAH11457.1
AK304557 mRNA Translation: BAH14214.1
AC104333 Genomic DNA No translation available.
CH471100 Genomic DNA Translation: EAW93376.1
CH471100 Genomic DNA Translation: EAW93377.1
CH471100 Genomic DNA Translation: EAW93378.1
BC048115 mRNA Translation: AAH48115.1 Different initiation.
BC113638 mRNA Translation: AAI13639.1
BC117485 mRNA Translation: AAI17486.1
BC143956 mRNA Translation: AAI43957.1
CCDSiCCDS31019.1 [Q17R31-1]
CCDS41465.1 [Q17R31-2]
CCDS53475.1 [Q17R31-3]
CCDS53476.1 [Q17R31-5]
CCDS53477.1 [Q17R31-4]
RefSeqiNP_001036017.1, NM_001042552.2 [Q17R31-1]
NP_001036018.1, NM_001042553.2 [Q17R31-2]
NP_001139641.1, NM_001146169.1 [Q17R31-5]
NP_001139642.1, NM_001146170.1 [Q17R31-4]
NP_001139643.1, NM_001146171.1 [Q17R31-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2Y1HX-ray2.50A/B5-274[»]
SMRiQ17R31
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi126118, 5 interactors
IntActiQ17R31, 4 interactors
STRINGi9606.ENSP00000431376

PTM databases

iPTMnetiQ17R31
PhosphoSitePlusiQ17R31

Genetic variation databases

BioMutaiTATDN3
DMDMi121948822

Proteomic databases

jPOSTiQ17R31
MassIVEiQ17R31
MaxQBiQ17R31
PaxDbiQ17R31
PeptideAtlasiQ17R31
PRIDEiQ17R31
ProteomicsDBi21114
22414
32260
61133 [Q17R31-1]
61134 [Q17R31-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
51781, 30 antibodies

The DNASU plasmid repository

More...
DNASUi
128387

Genome annotation databases

EnsembliENST00000366973; ENSP00000355940; ENSG00000203705 [Q17R31-2]
ENST00000366974; ENSP00000355941; ENSG00000203705 [Q17R31-1]
ENST00000526641; ENSP00000434801; ENSG00000203705 [Q17R31-4]
ENST00000531963; ENSP00000433755; ENSG00000203705 [Q17R31-5]
ENST00000532324; ENSP00000431376; ENSG00000203705 [Q17R31-3]
GeneIDi128387
KEGGihsa:128387
UCSCiuc001hjo.3, human [Q17R31-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
128387

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TATDN3
HGNCiHGNC:27010, TATDN3
HPAiENSG00000203705, Low tissue specificity
neXtProtiNX_Q17R31
OpenTargetsiENSG00000203705
PharmGKBiPA142670831
VEuPathDBiHostDB:ENSG00000203705.10

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3020, Eukaryota
GeneTreeiENSGT00720000108846
HOGENOMiCLU_031506_5_3_1
InParanoidiQ17R31
OMAiCHLDAGE
OrthoDBi988732at2759
PhylomeDBiQ17R31

Enzyme and pathway databases

PathwayCommonsiQ17R31

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
128387, 6 hits in 878 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TATDN3, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
128387
PharosiQ17R31, Tdark

Protein Ontology

More...
PROi
PR:Q17R31
RNActiQ17R31, protein

Gene expression databases

BgeeiENSG00000203705, Expressed in corpus callosum and 220 other tissues
ExpressionAtlasiQ17R31, baseline and differential
GenevisibleiQ17R31, HS

Family and domain databases

CDDicd01310, TatD_DNAse, 1 hit
InterProiView protein in InterPro
IPR032466, Metal_Hydrolase
IPR001130, TatD_family
PfamiView protein in Pfam
PF01026, TatD_DNase, 1 hit
PIRSFiPIRSF005902, DNase_TatD, 1 hit
SUPFAMiSSF51556, SSF51556, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTATD3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q17R31
Secondary accession number(s): A6NGS3
, B7Z1C1, B7Z978, B7ZLQ6, E9PJE5, E9PNH3, G3V151, Q4G0L1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: July 25, 2006
Last modified: February 10, 2021
This is version 127 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again