Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase akt-1

Gene

akt-1

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts downstream of PI3 kinase age-1 and kinase pdk-1 in the daf-2/insulin receptor-like transduction pathway. Phosphorylates Forkhead-related daf-16 and the longevity-promoting skn-1 transcription factors, which inhibits their entry into the nucleus and antagonizes their functions (PubMed:9716402, PubMed:11747825, PubMed:11381260, PubMed:15068796, PubMed:18358814). Has an essential role in regulating developmental arrest at the dauer stage (PubMed:10364160). Plays a role in immune function and pathogen resistance (PubMed:18782349). Regulates salt chemotaxis learning (PubMed:16950159). Downstream of age-1 and together with akt-2 and sgk-1, promotes cell survival during embryonic development (PubMed:25383666).9 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Cofactori

Activity regulationi

Phosphorylated and activated by pdk-1.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei222ATPPROSITE-ProRule annotation1
Active sitei316Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi199 – 207ATPPROSITE-ProRule annotation9

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionCalmodulin-binding, Developmental protein, Kinase, Serine/threonine-protein kinase, Transferase
Biological processImmunity, Innate immunity
LigandATP-binding, Lipid-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-CEL-1257604 PIP3 activates AKT signaling
R-CEL-1358803 Downregulation of ERBB2:ERBB3 signaling
R-CEL-1474151 Tetrahydrobiopterin (BH4) synthesis, recycling, salvage and regulation
R-CEL-165158 Activation of AKT2
R-CEL-198323 AKT phosphorylates targets in the cytosol
R-CEL-198693 AKT phosphorylates targets in the nucleus
R-CEL-199418 Negative regulation of the PI3K/AKT network
R-CEL-203615 eNOS activation
R-CEL-211163 AKT-mediated inactivation of FOXO1A
R-CEL-389357 CD28 dependent PI3K/Akt signaling
R-CEL-389513 CTLA4 inhibitory signaling
R-CEL-450385 Butyrate Response Factor 1 (BRF1) binds and destabilizes mRNA
R-CEL-450604 KSRP (KHSRP) binds and destabilizes mRNA
R-CEL-5218920 VEGFR2 mediated vascular permeability
R-CEL-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-CEL-8876198 RAB GEFs exchange GTP for GDP on RABs
R-CEL-8948751 Regulation of PTEN stability and activity
SignaLinkiQ17941

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase akt-1 (EC:2.7.11.1)
Alternative name(s):
Protein kinase B akt-1
Short name:
PKB akt-1
Gene namesi
Name:akt-1
ORF Names:C12D8.10
OrganismiCaenorhabditis elegans
Taxonomic identifieri6239 [NCBI]
Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
Proteomesi
  • UP000001940 Componenti: Chromosome V

Organism-specific databases

WormBaseiC12D8.10a ; CE15612 ; WBGene00000102 ; akt-1
C12D8.10b ; CE05274 ; WBGene00000102 ; akt-1
C12D8.10c ; CE31304 ; WBGene00000102 ; akt-1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Disruption phenotypei

Increased resistance to pathogens. Simultaneous knockdown of akt-1 and akt-2 result in dauer formation and a weak extension to life span.2 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi183A → T in mg144; causes a delay in apoptosis during embryonic development. Suppresses the dauer arrest phenotype of the age-1(mg44) null mutant. 2 Publications1
Mutagenesisi222K → M: Probable loss of kinase activity. Increased apoptosis during embryonic development in an akt-2 tm1075 mutant background. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000856151 – 541Serine/threonine-protein kinase akt-1Add BLAST541

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei350Phosphothreonine1 Publication1
Modified residuei517Phosphoserine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ17941
PaxDbiQ17941
PeptideAtlasiQ17941
PRIDEiQ17941

PTM databases

iPTMnetiQ17941

Expressioni

Tissue specificityi

Expressed in neurons, muscle cells of the pharynx, rectal gland cells, vulva and spermatheca.2 Publications

Developmental stagei

Expressed in late stage embryos and throughout life.1 Publication

Gene expression databases

BgeeiWBGene00000102 Expressed in 5 organ(s), highest expression level in adult organism

Interactioni

Subunit structurei

Interacts with pdk-1, sgk-1, akt-2 and daf-16 (PubMed:15068796). Part of a complex containing sgk-1, akt-1 and akt-2 (PubMed:15068796). Interacts with cmd-1 in the presence of Ca2+ (PubMed:17854888). Interacts with let-92 phosphatase regulatory subunit pptr-1 (PubMed:19249087).3 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi44454, 1 interactor
ComplexPortaliCPX-1129 Atk-1/Akt-2/Sgk-1 protein kinase complex
IntActiQ17941, 9 interactors
MINTiQ17941
STRINGi6239.C12D8.10b.1

Structurei

3D structure databases

ProteinModelPortaliQ17941
SMRiQ17941
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini15 – 118PHPROSITE-ProRule annotationAdd BLAST104
Domaini193 – 450Protein kinasePROSITE-ProRule annotationAdd BLAST258
Domaini451 – 528AGC-kinase C-terminalAdd BLAST78

Domaini

The PH domain binds to phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3) resulting in its targeting to the plasma membrane.1 Publication

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0598 Eukaryota
ENOG410XNPH LUCA
GeneTreeiENSGT00920000148938
HOGENOMiHOG000233033
InParanoidiQ17941
KOiK04456
OMAiCQIMSVD
OrthoDBiEOG091G06FF
PhylomeDBiQ17941

Family and domain databases

CDDicd01241 PH_PKB, 1 hit
Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR000961 AGC-kinase_C
IPR011009 Kinase-like_dom_sf
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR039026 PH_PKB
IPR017892 Pkinase_C
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR039027 RAC_alpha/beta
IPR008271 Ser/Thr_kinase_AS
PANTHERiPTHR24356:SF176 PTHR24356:SF176, 2 hits
PfamiView protein in Pfam
PF00169 PH, 1 hit
PF00069 Pkinase, 1 hit
PF00433 Pkinase_C, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00133 S_TK_X, 1 hit
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS51285 AGC_KINASE_CTER, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform a (identifier: Q17941-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSMTSLSTKS RRQEDVVIEG WLHKKGEHIR NWRPRYFMIF NDGALLGFRA
60 70 80 90 100
KPKEGQPFPE PLNDFMIKDA ATMLFEKPRP NMFMVRCLQW TTVIERTFYA
110 120 130 140 150
ESAEVRQRWI HAIESISKKY KGTNANPQEE LMETNQQPKI DEDSEFAGAA
160 170 180 190 200
HAIMGQPSSG HGDNCSIDFR ASMISIADTS EAAKRDKITM EDFDFLKVLG
210 220 230 240 250
KGTFGKVILC KEKRTQKLYA IKILKKDVII AREEVAHTLT ENRVLQRCKH
260 270 280 290 300
PFLTELKYSF QEQHYLCFVM QFANGGELFT HVRKCGTFSE PRARFYGAEI
310 320 330 340 350
VLALGYLHRC DIVYRDMKLE NLLLDKDGHI KIADFGLCKE EISFGDKTST
360 370 380 390 400
FCGTPEYLAP EVLDDHDYGR CVDWWGVGVV MYEMMCGRLP FYSKDHNKLF
410 420 430 440 450
ELIMAGDLRF PSKLSQEART LLTGLLVKDP TQRLGGGPED ALEICRADFF
460 470 480 490 500
RTVDWEATYR KEIEPPYKPN VQSETDTSYF DNEFTSQPVQ LTPPSRSGAL
510 520 530 540
ATVDEQEEMQ SNFTQFSFHN VMGSINRIHE ASEDNEDYDM G
Length:541
Mass (Da):62,200
Last modified:August 1, 1998 - v2
Checksum:i17FEDD1109926950
GO
Isoform b (identifier: Q17941-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     262-287: EQHYLCFVMQFANGGELFTHVRKCGT → TNDRLCFVMEFAIGGDLYYHLNREVQMNKEG
     298-298: A → S
     309-317: RCDIVYRDM → ANSIVYRDL

Show »
Length:546
Mass (Da):62,743
Checksum:i9719098DBED87AFB
GO
Isoform c (identifier: Q17941-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     255-541: Missing.

Note: No experimental confirmation available.
Show »
Length:254
Mass (Da):29,259
Checksum:iBC1E384AB75A7C77
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_038163255 – 541Missing in isoform c. CuratedAdd BLAST287
Alternative sequenceiVSP_017044262 – 287EQHYL…RKCGT → TNDRLCFVMEFAIGGDLYYH LNREVQMNKEG in isoform b. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_017045298A → S in isoform b. 1 Publication1
Alternative sequenceiVSP_017046309 – 317RCDIVYRDM → ANSIVYRDL in isoform b. 1 Publication9

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF072379 mRNA Translation: AAC62466.1
AF072380 mRNA Translation: AAC62467.1
Z73969 Genomic DNA Translation: CAA98238.1
Z73969 Genomic DNA Translation: CAA98240.1
Z73969 Genomic DNA Translation: CAD44085.1
PIRiT43232
T43233
RefSeqiNP_001023645.1, NM_001028474.4 [Q17941-1]
NP_001023646.1, NM_001028475.2
NP_001023647.1, NM_001028476.3 [Q17941-3]
UniGeneiCel.5036

Genome annotation databases

EnsemblMetazoaiC12D8.10a.1; C12D8.10a.1; WBGene00000102 [Q17941-1]
C12D8.10a.2; C12D8.10a.2; WBGene00000102 [Q17941-1]
GeneIDi179424
KEGGicel:CELE_C12D8.10
UCSCiC12D8.10b.1 c. elegans [Q17941-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiAKT1_CAEEL
AccessioniPrimary (citable) accession number: Q17941
Secondary accession number(s): Q17942, Q8MQE0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 24, 2006
Last sequence update: August 1, 1998
Last modified: September 12, 2018
This is version 161 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again