Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase akt-1

Gene

akt-1

Organism
Caenorhabditis elegans
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts downstream of PI3 kinase age-1 and kinase pdk-1 in the daf-2/insulin receptor-like transduction pathway. Phosphorylates Forkhead-related daf-16 and the longevity-promoting skn-1 transcription factors, which inhibits their entry into the nucleus and antagonizes their functions (PubMed:9716402, PubMed:11747825, PubMed:11381260, PubMed:15068796, PubMed:18358814). Has an essential role in regulating developmental arrest at the dauer stage (PubMed:10364160). Plays a role in immune function and pathogen resistance (PubMed:18782349). Regulates salt chemotaxis learning (PubMed:16950159). Downstream of age-1 and together with akt-2 and sgk-1, promotes cell survival during embryonic development (PubMed:25383666).9 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Phosphorylated and activated by pdk-1.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei222ATPPROSITE-ProRule annotation1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei316Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi199 – 207ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalmodulin-binding, Developmental protein, Kinase, Serine/threonine-protein kinase, Transferase
Biological processImmunity, Innate immunity
LigandATP-binding, Lipid-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-CEL-1257604 PIP3 activates AKT signaling
R-CEL-165158 Activation of AKT2
R-CEL-198323 AKT phosphorylates targets in the cytosol
R-CEL-198693 AKT phosphorylates targets in the nucleus
R-CEL-199418 Negative regulation of the PI3K/AKT network
R-CEL-211163 AKT-mediated inactivation of FOXO1A
R-CEL-354192 Integrin alphaIIb beta3 signaling
R-CEL-389357 CD28 dependent PI3K/Akt signaling
R-CEL-389513 CTLA4 inhibitory signaling
R-CEL-392451 G beta:gamma signalling through PI3Kgamma
R-CEL-450385 Butyrate Response Factor 1 (BRF1) binds and destabilizes mRNA
R-CEL-450604 KSRP (KHSRP) binds and destabilizes mRNA
R-CEL-5218920 VEGFR2 mediated vascular permeability
R-CEL-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-CEL-8876198 RAB GEFs exchange GTP for GDP on RABs
R-CEL-8948751 Regulation of PTEN stability and activity
R-CEL-9604323 Negative regulation of NOTCH4 signaling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q17941

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/threonine-protein kinase akt-1 (EC:2.7.11.1)
Alternative name(s):
Protein kinase B akt-1
Short name:
PKB akt-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:akt-1
ORF Names:C12D8.10
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiCaenorhabditis elegans
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri6239 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaNematodaChromadoreaRhabditidaRhabditinaRhabditomorphaRhabditoideaRhabditidaePeloderinaeCaenorhabditis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001940 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome V

Organism-specific databases

WormBase

More...
WormBasei
C12D8.10a ; CE15612 ; WBGene00000102 ; akt-1
C12D8.10b ; CE05274 ; WBGene00000102 ; akt-1
C12D8.10c ; CE31304 ; WBGene00000102 ; akt-1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Increased resistance to pathogens. Simultaneous knockdown of akt-1 and akt-2 result in dauer formation and a weak extension to life span.2 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi183A → T in mg144; causes a delay in apoptosis during embryonic development. Suppresses the dauer arrest phenotype of the age-1(mg44) null mutant. 2 Publications1
Mutagenesisi222K → M: Probable loss of kinase activity. Increased apoptosis during embryonic development in an akt-2 tm1075 mutant background. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000856151 – 541Serine/threonine-protein kinase akt-1Add BLAST541

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei350Phosphothreonine1 Publication1
Modified residuei517Phosphoserine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q17941

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q17941

PeptideAtlas

More...
PeptideAtlasi
Q17941

PRoteomics IDEntifications database

More...
PRIDEi
Q17941

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q17941

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in neurons, muscle cells of the pharynx, rectal gland cells, vulva and spermatheca.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in late stage embryos and throughout life.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
WBGene00000102 Expressed in 5 organ(s), highest expression level in adult organism

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with pdk-1, sgk-1, akt-2 and daf-16 (PubMed:15068796). Part of a complex containing sgk-1, akt-1 and akt-2 (PubMed:15068796). Interacts with cmd-1 in the presence of Ca2+ (PubMed:17854888). Interacts with let-92 phosphatase regulatory subunit pptr-1 (PubMed:19249087).3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
44454, 1 interactor

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-1129 Atk-1/Akt-2/Sgk-1 protein kinase complex

Protein interaction database and analysis system

More...
IntActi
Q17941, 9 interactors

Molecular INTeraction database

More...
MINTi
Q17941

STRING: functional protein association networks

More...
STRINGi
6239.C12D8.10b.1

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q17941

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q17941

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini15 – 118PHPROSITE-ProRule annotationAdd BLAST104
Domaini193 – 450Protein kinasePROSITE-ProRule annotationAdd BLAST258
Domaini451 – 528AGC-kinase C-terminalAdd BLAST78

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PH domain binds to phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3) resulting in its targeting to the plasma membrane.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0598 Eukaryota
ENOG410XNPH LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000168810

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000233033

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q17941

KEGG Orthology (KO)

More...
KOi
K04456

Identification of Orthologs from Complete Genome Data

More...
OMAi
RGCQIMS

Database of Orthologous Groups

More...
OrthoDBi
EOG091G06FF

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q17941

Family and domain databases

Conserved Domains Database

More...
CDDi
cd01241 PH_PKB, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000961 AGC-kinase_C
IPR011009 Kinase-like_dom_sf
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR039026 PH_PKB
IPR017892 Pkinase_C
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR039027 RAC_alpha/beta
IPR008271 Ser/Thr_kinase_AS

The PANTHER Classification System

More...
PANTHERi
PTHR24356:SF176 PTHR24356:SF176, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00169 PH, 1 hit
PF00069 Pkinase, 1 hit
PF00433 Pkinase_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00233 PH, 1 hit
SM00133 S_TK_X, 1 hit
SM00220 S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51285 AGC_KINASE_CTER, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform a (identifier: Q17941-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSMTSLSTKS RRQEDVVIEG WLHKKGEHIR NWRPRYFMIF NDGALLGFRA
60 70 80 90 100
KPKEGQPFPE PLNDFMIKDA ATMLFEKPRP NMFMVRCLQW TTVIERTFYA
110 120 130 140 150
ESAEVRQRWI HAIESISKKY KGTNANPQEE LMETNQQPKI DEDSEFAGAA
160 170 180 190 200
HAIMGQPSSG HGDNCSIDFR ASMISIADTS EAAKRDKITM EDFDFLKVLG
210 220 230 240 250
KGTFGKVILC KEKRTQKLYA IKILKKDVII AREEVAHTLT ENRVLQRCKH
260 270 280 290 300
PFLTELKYSF QEQHYLCFVM QFANGGELFT HVRKCGTFSE PRARFYGAEI
310 320 330 340 350
VLALGYLHRC DIVYRDMKLE NLLLDKDGHI KIADFGLCKE EISFGDKTST
360 370 380 390 400
FCGTPEYLAP EVLDDHDYGR CVDWWGVGVV MYEMMCGRLP FYSKDHNKLF
410 420 430 440 450
ELIMAGDLRF PSKLSQEART LLTGLLVKDP TQRLGGGPED ALEICRADFF
460 470 480 490 500
RTVDWEATYR KEIEPPYKPN VQSETDTSYF DNEFTSQPVQ LTPPSRSGAL
510 520 530 540
ATVDEQEEMQ SNFTQFSFHN VMGSINRIHE ASEDNEDYDM G
Length:541
Mass (Da):62,200
Last modified:August 1, 1998 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i17FEDD1109926950
GO
Isoform b (identifier: Q17941-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     262-287: EQHYLCFVMQFANGGELFTHVRKCGT → TNDRLCFVMEFAIGGDLYYHLNREVQMNKEG
     298-298: A → S
     309-317: RCDIVYRDM → ANSIVYRDL

Show »
Length:546
Mass (Da):62,743
Checksum:i9719098DBED87AFB
GO
Isoform c (identifier: Q17941-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     255-541: Missing.

Note: No experimental confirmation available.
Show »
Length:254
Mass (Da):29,259
Checksum:iBC1E384AB75A7C77
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_038163255 – 541Missing in isoform c. CuratedAdd BLAST287
Alternative sequenceiVSP_017044262 – 287EQHYL…RKCGT → TNDRLCFVMEFAIGGDLYYH LNREVQMNKEG in isoform b. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_017045298A → S in isoform b. 1 Publication1
Alternative sequenceiVSP_017046309 – 317RCDIVYRDM → ANSIVYRDL in isoform b. 1 Publication9

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF072379 mRNA Translation: AAC62466.1
AF072380 mRNA Translation: AAC62467.1
Z73969 Genomic DNA Translation: CAA98238.1
Z73969 Genomic DNA Translation: CAA98240.1
Z73969 Genomic DNA Translation: CAD44085.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T43232
T43233

NCBI Reference Sequences

More...
RefSeqi
NP_001023645.1, NM_001028474.4 [Q17941-1]
NP_001023646.1, NM_001028475.2 [Q17941-2]
NP_001023647.1, NM_001028476.3 [Q17941-3]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Cel.5036

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
C12D8.10a.1; C12D8.10a.1; WBGene00000102 [Q17941-1]
C12D8.10a.2; C12D8.10a.2; WBGene00000102 [Q17941-1]
C12D8.10b.1; C12D8.10b.1; WBGene00000102 [Q17941-2]
C12D8.10b.2; C12D8.10b.2; WBGene00000102 [Q17941-2]
C12D8.10c; C12D8.10c; WBGene00000102 [Q17941-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
179424

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
cel:CELE_C12D8.10

UCSC genome browser

More...
UCSCi
C12D8.10b.1 c. elegans [Q17941-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF072379 mRNA Translation: AAC62466.1
AF072380 mRNA Translation: AAC62467.1
Z73969 Genomic DNA Translation: CAA98238.1
Z73969 Genomic DNA Translation: CAA98240.1
Z73969 Genomic DNA Translation: CAD44085.1
PIRiT43232
T43233
RefSeqiNP_001023645.1, NM_001028474.4 [Q17941-1]
NP_001023646.1, NM_001028475.2 [Q17941-2]
NP_001023647.1, NM_001028476.3 [Q17941-3]
UniGeneiCel.5036

3D structure databases

ProteinModelPortaliQ17941
SMRiQ17941
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi44454, 1 interactor
ComplexPortaliCPX-1129 Atk-1/Akt-2/Sgk-1 protein kinase complex
IntActiQ17941, 9 interactors
MINTiQ17941
STRINGi6239.C12D8.10b.1

PTM databases

iPTMnetiQ17941

Proteomic databases

EPDiQ17941
PaxDbiQ17941
PeptideAtlasiQ17941
PRIDEiQ17941

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiC12D8.10a.1; C12D8.10a.1; WBGene00000102 [Q17941-1]
C12D8.10a.2; C12D8.10a.2; WBGene00000102 [Q17941-1]
C12D8.10b.1; C12D8.10b.1; WBGene00000102 [Q17941-2]
C12D8.10b.2; C12D8.10b.2; WBGene00000102 [Q17941-2]
C12D8.10c; C12D8.10c; WBGene00000102 [Q17941-3]
GeneIDi179424
KEGGicel:CELE_C12D8.10
UCSCiC12D8.10b.1 c. elegans [Q17941-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
179424
WormBaseiC12D8.10a ; CE15612 ; WBGene00000102 ; akt-1
C12D8.10b ; CE05274 ; WBGene00000102 ; akt-1
C12D8.10c ; CE31304 ; WBGene00000102 ; akt-1

Phylogenomic databases

eggNOGiKOG0598 Eukaryota
ENOG410XNPH LUCA
GeneTreeiENSGT00940000168810
HOGENOMiHOG000233033
InParanoidiQ17941
KOiK04456
OMAiRGCQIMS
OrthoDBiEOG091G06FF
PhylomeDBiQ17941

Enzyme and pathway databases

ReactomeiR-CEL-1257604 PIP3 activates AKT signaling
R-CEL-165158 Activation of AKT2
R-CEL-198323 AKT phosphorylates targets in the cytosol
R-CEL-198693 AKT phosphorylates targets in the nucleus
R-CEL-199418 Negative regulation of the PI3K/AKT network
R-CEL-211163 AKT-mediated inactivation of FOXO1A
R-CEL-354192 Integrin alphaIIb beta3 signaling
R-CEL-389357 CD28 dependent PI3K/Akt signaling
R-CEL-389513 CTLA4 inhibitory signaling
R-CEL-392451 G beta:gamma signalling through PI3Kgamma
R-CEL-450385 Butyrate Response Factor 1 (BRF1) binds and destabilizes mRNA
R-CEL-450604 KSRP (KHSRP) binds and destabilizes mRNA
R-CEL-5218920 VEGFR2 mediated vascular permeability
R-CEL-6811558 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
R-CEL-8876198 RAB GEFs exchange GTP for GDP on RABs
R-CEL-8948751 Regulation of PTEN stability and activity
R-CEL-9604323 Negative regulation of NOTCH4 signaling
SignaLinkiQ17941

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q17941

Gene expression databases

BgeeiWBGene00000102 Expressed in 5 organ(s), highest expression level in adult organism

Family and domain databases

CDDicd01241 PH_PKB, 1 hit
Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR000961 AGC-kinase_C
IPR011009 Kinase-like_dom_sf
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR039026 PH_PKB
IPR017892 Pkinase_C
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR039027 RAC_alpha/beta
IPR008271 Ser/Thr_kinase_AS
PANTHERiPTHR24356:SF176 PTHR24356:SF176, 2 hits
PfamiView protein in Pfam
PF00169 PH, 1 hit
PF00069 Pkinase, 1 hit
PF00433 Pkinase_C, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00133 S_TK_X, 1 hit
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS51285 AGC_KINASE_CTER, 1 hit
PS50003 PH_DOMAIN, 1 hit
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAKT1_CAEEL
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q17941
Secondary accession number(s): Q17942, Q8MQE0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 24, 2006
Last sequence update: August 1, 1998
Last modified: December 5, 2018
This is version 164 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programCaenorhabditis annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Caenorhabditis elegans
    Caenorhabditis elegans: entries, gene names and cross-references to WormBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again