Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein lingerer

Gene

lig

Organism
Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Protein inferred from homologyi <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts in the nervous system to mediate the control of copulatory organs during courtship.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processBehavior

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein lingerer
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ligBy similarity
ORF Names:AAEL009607
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiAedes aegypti (Yellowfever mosquito) (Culex aegypti)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7159 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraNematoceraCulicoideaCulicidaeCulicinaeAediniAedesStegomyia
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000008820 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unassembled WGS sequence

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003146191 – 1250Protein lingererAdd BLAST1250

Keywords - PTMi

Phosphoprotein

Proteomic databases

PRoteomics IDEntifications database

More...
PRIDEi
Q16VD3

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
7159.AAEL009607-PA

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q16VD3

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q16VD3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini107 – 147UBASequence analysisAdd BLAST41

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi175 – 284Gly-richSequence analysisAdd BLAST110
Compositional biasi359 – 424Gln-richSequence analysisAdd BLAST66
Compositional biasi469 – 945Ser-richSequence analysisAdd BLAST477

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGWX Eukaryota
ENOG4110RI8 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000046379

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q16VD3

Identification of Orthologs from Complete Genome Data

More...
OMAi
QTRRYPN

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0EFG

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q16VD3

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR022166 DUF3697_Uba2
IPR009060 UBA-like_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12478 DUF3697, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46934 SSF46934, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform A1 Publication (identifier: Q16VD3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSTQTRSGGG GGGRNKSKAS KENKENAGMD EQPQPQLQQQ KGNATVNSGG
60 70 80 90 100
GEKQKKGIDN SGSKGGDSKD KQHQQTTTHT IKTKQPTAEQ IRIAQITDIK
110 120 130 140 150
SGMDDPKIQE KIQKLMETTQ RSEEEVCCAL QECDNDLDRA VIFLLETLPV
160 170 180 190 200
GAFATTSKKK KNKSQNKEQN DSATGDGDWD NGGNVGSGSG GGGGLSADSK
210 220 230 240 250
DRRGNRPGNQ RSGGGPGGPG SRGGRGGFRD GERGGDRDRN GFDRGGRGPR
260 270 280 290 300
GRDGRDGGPG RGSYGGGSRG GRGGGPRVGT RGPGMRESNR APRITDHQEI
310 320 330 340 350
DVWDSVATPS ANDLNKPEES SAFADTWGDW DNEEYTGSLS DTKVFTPSTQ
360 370 380 390 400
VAATTPPAQQ QQQQPTSSST QSQPTSQPQQ PTTPQPVQSQ IAPVQPATVS
410 420 430 440 450
SSVTSLEQQI LNPLQPKETD LVQQYSTTVV SSTATAAAAA TVQYPDLHSA
460 470 480 490 500
PSAAQHLRQA LEMPQINNSS SSLSAEQSQY FNTLSSQNSN LQSSVVNSYQ
510 520 530 540 550
QSSVQYPTSY GSSSTYSDQV TSSQQAPTAR RQRARVPPPS KIPSSAVEMP
560 570 580 590 600
GDSLNNIGYL DVQFGGLDFG TDDTFDSVPV TDKFNTNSLE QSTPSSVQLP
610 620 630 640 650
SAVQPTQSEV NDYQSKPSVV NNLQQKSSLT SSLQSTQILP GQSDALTATQ
660 670 680 690 700
SDSLSNSYSQ RNTSTVVPSS VSSGVNVNSI NSTTSTLEQL TKTDPYSQST
710 720 730 740 750
GTNAGSGGYQ NVSYSTSQAN KTSSYPSSAA PQGYNNSSYS STQVSTNTYP
760 770 780 790 800
ASSNNYSSYN QSGVNSYQQP SSNVSSSVVP NNNSTSSVGV STVNQSNPNL
810 820 830 840 850
PVNNNVSNNS SSNTNTGYLS SQYPVSQTSS AFPSQQSYQN SSQNVYGNTG
860 870 880 890 900
LNSNTGYSGS TSTSSGQYSN FSSSKLKDTP VSTQFDSVSS STVSNNNSAN
910 920 930 940 950
NNSVSSSSSS LPNSSVVSTT SMSSPSLGLT NTKVTNSTAK SSSSSGTGVV
960 970 980 990 1000
PNIPMVSPYI QPGVPFYQQP LYSYEDLQML QQRMSHVPGY YDMNYQTPTS
1010 1020 1030 1040 1050
LGAAGVRDAN LGSVAYSTMS DGRFTRTDNN SSPVSNVPST MSQQTGSGGP
1060 1070 1080 1090 1100
MLNLPYAYFY GGNVMPGGFQ YGTPAVYPPQ PMATNATSGG QFQKPAYNSG
1110 1120 1130 1140 1150
YGTSGYDTLS QSGQDYNKNP YPSSGVGQQS KGQTVSNQQS AGGSGSDIAP
1160 1170 1180 1190 1200
SMYGKSHVAL NKVNSYEKQS FHSGTPPPYN IAGTQTAGAT SGQPYGQHLY
1210 1220 1230 1240 1250
IPQIPTHHNI NMHQAMHQDS NSSGQRPQSN SQGKTATKQG YSPSYWTGQN
Note: No experimental confirmation available.Curated
Length:1,250
Mass (Da):131,545
Last modified:July 25, 2006 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1AD19FE9F376E209
GO
Isoform B1 Publication (identifier: Q16VD3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     921-939: SMSSPSLGLTNTKVTNSTA → T
     1219-1250: DSNSSGQRPQSNSQGKTATKQGYSPSYWTGQN → V

Note: No experimental confirmation available.Curated
Show »
Length:1,201
Mass (Da):126,438
Checksum:iF08288F8624C12DE
GO
Isoform C1 Publication (identifier: Q16VD3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     921-939: SMSSPSLGLTNTKVTNSTA → T

Note: No experimental confirmation available.Curated
Show »
Length:1,232
Mass (Da):129,768
Checksum:i2209CDB7F6207243
GO
Isoform D1 Publication (identifier: Q16VD3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     812-812: Missing.
     921-939: SMSSPSLGLTNTKVTNSTA → T

Note: No experimental confirmation available.Curated
Show »
Length:1,231
Mass (Da):129,681
Checksum:i14A0037957D0F3D3
GO
Isoform E1 Publication (identifier: Q16VD3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     921-939: SMSSPSLGLTNTKVTNSTA → T
     1218-1218: Q → QMDNRTYNSGSGVMR

Note: No experimental confirmation available.Curated
Show »
Length:1,246
Mass (Da):131,338
Checksum:iEB4F7EB1FBA4664D
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_052635812Missing in isoform D. 1 Publication1
Alternative sequenceiVSP_052636921 – 939SMSSP…TNSTA → T in isoform B, isoform C, isoform D and isoform E. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_0526371218Q → QMDNRTYNSGSGVMR in isoform E. 1 Publication1
Alternative sequenceiVSP_0526381219 – 1250DSNSS…WTGQN → V in isoform B. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
CH477597 Genomic DNA Translation: EAT38499.1
CH477597 Genomic DNA Translation: EAT38500.1
CH477597 Genomic DNA Translation: EAT38501.1
CH477597 Genomic DNA Translation: EAT38502.1
CH477597 Genomic DNA Translation: EAT38503.1

NCBI Reference Sequences

More...
RefSeqi
XP_001653854.1, XM_001653804.1
XP_001653855.1, XM_001653805.1
XP_001653856.1, XM_001653806.1
XP_001653857.1, XM_001653807.1
XP_001653858.1, XM_001653808.1

Genome annotation databases

Bioinformatics Resource for Invertebrate Vectors of Human Pathogens

More...
VectorBasei
AAEL009607-RT; AAEL009607-PT; AAEL009607

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CH477597 Genomic DNA Translation: EAT38499.1
CH477597 Genomic DNA Translation: EAT38500.1
CH477597 Genomic DNA Translation: EAT38501.1
CH477597 Genomic DNA Translation: EAT38502.1
CH477597 Genomic DNA Translation: EAT38503.1
RefSeqiXP_001653854.1, XM_001653804.1
XP_001653855.1, XM_001653805.1
XP_001653856.1, XM_001653806.1
XP_001653857.1, XM_001653807.1
XP_001653858.1, XM_001653808.1

3D structure databases

ProteinModelPortaliQ16VD3
SMRiQ16VD3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi7159.AAEL009607-PA

Proteomic databases

PRIDEiQ16VD3

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

VectorBaseiAAEL009607-RT; AAEL009607-PT; AAEL009607

Phylogenomic databases

eggNOGiENOG410IGWX Eukaryota
ENOG4110RI8 LUCA
HOGENOMiHOG000046379
InParanoidiQ16VD3
OMAiQTRRYPN
OrthoDBiEOG091G0EFG
PhylomeDBiQ16VD3

Family and domain databases

InterProiView protein in InterPro
IPR022166 DUF3697_Uba2
IPR009060 UBA-like_sf
PfamiView protein in Pfam
PF12478 DUF3697, 1 hit
SUPFAMiSSF46934 SSF46934, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLIG_AEDAE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q16VD3
Secondary accession number(s): Q16VC9
, Q16VD0, Q16VD1, Q16VD2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: July 25, 2006
Last modified: September 12, 2018
This is version 70 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again