Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 215 (16 Oct 2019)
Sequence version 3 (26 Feb 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Thioredoxin reductase 1, cytoplasmic

Gene

TXNRD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Isoform 1 may possess glutaredoxin activity as well as thioredoxin reductase activity and induces actin and tubulin polymerization, leading to formation of cell membrane protrusions. Isoform 4 enhances the transcriptional activity of estrogen receptors alpha and beta while isoform 5 enhances the transcriptional activity of the beta receptor only. Isoform 5 also mediates cell death induced by a combination of interferon-beta and retinoic acid.4 Publications

Miscellaneous

The thioredoxin reductase active site is a redox-active disulfide bond. The selenocysteine residue is also essential for catalytic activity.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

FADNote: Binds 1 FAD per subunit.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei622Proton acceptorBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi192 – 209FADBy similarityAdd BLAST18

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionOxidoreductase
Biological processElectron transport, Transport
LigandFAD, Flavoprotein, NADP

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
1.8.1.9 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1989781 PPARA activates gene expression
R-HSA-2408550 Metabolism of ingested H2SeO4 and H2SeO3 into H2Se
R-HSA-3299685 Detoxification of Reactive Oxygen Species
R-HSA-499943 Interconversion of nucleotide di- and triphosphates
R-HSA-5263617 Metabolism of ingested MeSeO2H into MeSeH
R-HSA-5336415 Uptake and function of diphtheria toxin
R-HSA-5628897 TP53 Regulates Metabolic Genes

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Thioredoxin reductase 1, cytoplasmic (EC:1.8.1.9)
Short name:
TR
Alternative name(s):
Gene associated with retinoic and interferon-induced mortality 12 protein
Short name:
GRIM-12
Short name:
Gene associated with retinoic and IFN-induced mortality 12 protein
KM-102-derived reductase-like factor
Thioredoxin reductase TR1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TXNRD1
Synonyms:GRIM12, KDRF
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12437 TXNRD1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601112 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q16881

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
7296

Open Targets

More...
OpenTargetsi
ENSG00000198431

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37093

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q16881

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL1927

Drug and drug target database

More...
DrugBanki
DB01169 Arsenic trioxide
DB03147 Flavin adenine dinucleotide
DB04106 Fotemustine
DB05428 motexafin gadolinium
DB02338 Nadph Dihydro-Nicotinamide-Adenine-Dinucleotidephosphate
DB05448 PX-12
DB11127 Selenious acid
DB11135 Selenium
DB03566 Spermidine

DrugCentral

More...
DrugCentrali
Q16881

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TXNRD1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
172046253

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000302861 – 649Thioredoxin reductase 1, cytoplasmicAdd BLAST649

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi209 ↔ 214Redox-activeBy similarity
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei218N6-succinyllysineBy similarity1
Modified residuei281PhosphotyrosineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki647 ↔ 648Cysteinyl-selenocysteine (Cys-Sec)By similarity
Isoform 5 (identifier: Q16881-5)
Modified residuei1N-acetylmethionineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

The N-terminus of isoform 5 is blocked.
ISGylated.1 Publication

Keywords - PTMi

Acetylation, Disulfide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q16881

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q16881

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q16881

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q16881

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q16881

PeptideAtlas

More...
PeptideAtlasi
Q16881

PRoteomics IDEntifications database

More...
PRIDEi
Q16881

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
22254
27407
61119 [Q16881-1]
61120 [Q16881-2]
61121 [Q16881-3]
61122 [Q16881-4]
61123 [Q16881-5]
61124 [Q16881-6]

2D gel databases

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
IPI00554786

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q16881

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q16881

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q16881

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is expressed predominantly in Leydig cells (at protein level). Also expressed in ovary, spleen, heart, liver, kidney and pancreas and in a number of cancer cell lines. Isoform 4 is widely expressed with highest levels in kidney, testis, uterus, ovary, prostate, placenta and fetal liver.2 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Isoform 5 is induced by a combination of interferon-beta and retinoic acid (at protein level). Isoform 1 is induced by estradiol or testosterone in HeLa cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000198431 Expressed in 235 organ(s), highest expression level in adrenal tissue

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q16881 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q16881 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB004607
CAB015834
HPA001395
HPA043871

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Isoform 4 interacts with ESR1 and ESR2.

Interacts with HERC5.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
113147, 45 interactors

Protein interaction database and analysis system

More...
IntActi
Q16881, 14 interactors

Molecular INTeraction database

More...
MINTi
Q16881

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000434516

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q16881

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1649
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q16881

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q16881

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini56 – 156GlutaredoxinPROSITE-ProRule annotationAdd BLAST101

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The N-terminal glutaredoxin domain found in isoform 1 does not contain the C-P-Y-C redox-active motif normally found in glutaredoxins and has been found to be inactive in classical glutaredoxin assays.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Redox-active center

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1752 Eukaryota
KOG4716 Eukaryota
COG1249 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160180

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q16881

KEGG Orthology (KO)

More...
KOi
K22182

Database of Orthologous Groups

More...
OrthoDBi
581771at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q16881

TreeFam database of animal gene trees

More...
TreeFami
TF314782

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.390.30, 1 hit
3.50.50.60, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036188 FAD/NAD-bd_sf
IPR023753 FAD/NAD-binding_dom
IPR016156 FAD/NAD-linked_Rdtase_dimer_sf
IPR002109 Glutaredoxin
IPR001100 Pyr_nuc-diS_OxRdtase
IPR004099 Pyr_nucl-diS_OxRdtase_dimer
IPR012999 Pyr_OxRdtase_I_AS
IPR036249 Thioredoxin-like_sf
IPR006338 Thioredoxin/glutathione_Rdtase

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00462 Glutaredoxin, 1 hit
PF07992 Pyr_redox_2, 1 hit
PF02852 Pyr_redox_dim, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF000350 Mercury_reductase_MerA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51905 SSF51905, 1 hit
SSF52833 SSF52833, 1 hit
SSF55424 SSF55424, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR01438 TGR, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51354 GLUTAREDOXIN_2, 1 hit
PS00076 PYRIDINE_REDOX_1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 14 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q16881-1) [UniParc]FASTAAdd to basket
Also known as: V, TXNRD1_v3

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGCAEGKAVA AAAPTELQTK GKNGDGRRRS AKDHHPGKTL PENPAGFTST
60 70 80 90 100
ATADSRALLQ AYIDGHSVVI FSRSTCTRCT EVKKLFKSLC VPYFVLELDQ
110 120 130 140 150
TEDGRALEGT LSELAAETDL PVVFVKQRKI GGHGPTLKAY QEGRLQKLLK
160 170 180 190 200
MNGPEDLPKS YDYDLIIIGG GSGGLAAAKE AAQYGKKVMV LDFVTPTPLG
210 220 230 240 250
TRWGLGGTCV NVGCIPKKLM HQAALLGQAL QDSRNYGWKV EETVKHDWDR
260 270 280 290 300
MIEAVQNHIG SLNWGYRVAL REKKVVYENA YGQFIGPHRI KATNNKGKEK
310 320 330 340 350
IYSAERFLIA TGERPRYLGI PGDKEYCISS DDLFSLPYCP GKTLVVGASY
360 370 380 390 400
VALECAGFLA GIGLDVTVMV RSILLRGFDQ DMANKIGEHM EEHGIKFIRQ
410 420 430 440 450
FVPIKVEQIE AGTPGRLRVV AQSTNSEEII EGEYNTVMLA IGRDACTRKI
460 470 480 490 500
GLETVGVKIN EKTGKIPVTD EEQTNVPYIY AIGDILEDKV ELTPVAIQAG
510 520 530 540 550
RLLAQRLYAG STVKCDYENV PTTVFTPLEY GACGLSEEKA VEKFGEENIE
560 570 580 590 600
VYHSYFWPLE WTIPSRDNNK CYAKIICNTK DNERVVGFHV LGPNAGEVTQ
610 620 630 640
GFAAALKCGL TKKQLDSTIG IHPVCAEVFT TLSVTKRSGA SILQAGCUG
Note: Minor isoform.
Length:649
Mass (Da):70,906
Last modified:February 26, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5A51C3F77EB03EFE
GO
Isoform 2 (identifier: Q16881-2) [UniParc]FASTAAdd to basket
Also known as: II, TXNRD1_v4

The sequence of this isoform differs from the canonical sequence as follows:
     1-106: Missing.
     107-138: LEGTLSELAAETDLPVVFVKQRKIGGHGPTLK → MLSRLVLNSWAQAIIRPRPPKVLGLQVTTFSE

Show »
Length:543
Mass (Da):59,787
Checksum:i990DB8D334659B4D
GO
Isoform 3 (identifier: Q16881-3) [UniParc]FASTAAdd to basket
Also known as: III, TXNRD1_v5

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.
     52-100: TADSRALLQA...VPYFVLELDQ → MQQVMLTCKG...LTRSALLLCH

Show »
Length:598
Mass (Da):65,567
Checksum:i81F496F5BB85A49E
GO
Isoform 4 (identifier: Q16881-4) [UniParc]FASTAAdd to basket
Also known as: IV, TXNRD1_v2, TrxR1b

The sequence of this isoform differs from the canonical sequence as follows:
     1-98: Missing.
     99-101: DQT → MSC

Show »
Length:551
Mass (Da):60,419
Checksum:iF54B034AADF51E5B
GO
Isoform 5 (identifier: Q16881-5) [UniParc]FASTAAdd to basket
Also known as: I, TXNRD1_v1, TrxR1a

The sequence of this isoform differs from the canonical sequence as follows:
     1-150: Missing.

Note: Major isoform. The N-terminus of the sequence is processed into a mature form that lacks residues Met-151 and Asn-152 at the N-terminus.Combined sources
Show »
Length:499
Mass (Da):54,754
Checksum:iC24BAEB4A573EABE
GO
Isoform 6 (identifier: Q16881-6) [UniParc]FASTAAdd to basket
Also known as: VI

The sequence of this isoform differs from the canonical sequence as follows:
     1-139: MGCAEGKAVA...IGGHGPTLKA → MPVDDYWLCL...QERNVQFGLA

Show »
Length:614
Mass (Da):67,266
Checksum:i9C635E1C6EA94934
GO
Isoform 7 (identifier: Q16881-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-188: Missing.

Note: No experimental confirmation.
Show »
Length:461
Mass (Da):50,873
Checksum:i07D3A620A6BD82EA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 14 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WSY9A0A087WSY9_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
648Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A182DWI3A0A182DWI3_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
568Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WSW9A0A087WSW9_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
548Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E2QRB9E2QRB9_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
460Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W809F8W809_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
498Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PIR7E9PIR7_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
482Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PJU2E9PJU2_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PKD3E9PKD3_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PIZ5E9PIZ5_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PKI4E9PKI4_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
72Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB35418 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated
The sequence AAC69621 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated
The sequence AAF15900 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated
The sequence AAV38446 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated
The sequence AAZ67916 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated
The sequence BAA13674 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated
The sequence BAH11490 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated
The sequence BAH12374 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated
The sequence BAH14140 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated
The sequence CAA04503 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated
The sequence CAA62629 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated
The sequence CAG38744 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated
The sequence EAW97745 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti153G → S in AAQ62473 (PubMed:14980707).Curated1
Sequence conflicti181A → P in AAF15900 (Ref. 6) Curated1
Sequence conflicti194V → G in AAF15900 (Ref. 6) Curated1
Sequence conflicti200G → E in AAQ62469 (PubMed:14980707).Curated1
Sequence conflicti202R → K in AAQ62463 (PubMed:14980707).Curated1
Sequence conflicti215I → N in AAQ62463 (PubMed:14980707).Curated1
Sequence conflicti297G → D in BAH11490 (PubMed:14702039).Curated1
Sequence conflicti306R → S in AAB35418 (PubMed:7589432).Curated1
Sequence conflicti306R → S in CAA62629 (PubMed:7589432).Curated1
Sequence conflicti306R → S in AAL15432 (PubMed:14980707).Curated1
Sequence conflicti365D → N in AAC69621 (PubMed:9774665).Curated1
Sequence conflicti437V → A in BAH12374 (PubMed:14702039).Curated1
Sequence conflicti441I → M in BAH12374 (PubMed:14702039).Curated1
Sequence conflicti449K → R in CAG38744 (Ref. 8) Curated1
Sequence conflicti641S → R in AAC69621 (PubMed:9774665).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051776365D → G2 PublicationsCorresponds to variant dbSNP:rs1127954Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0538191 – 188Missing in isoform 7. 1 PublicationAdd BLAST188
Alternative sequenceiVSP_0315581 – 150Missing in isoform 5. 7 PublicationsAdd BLAST150
Alternative sequenceiVSP_0315591 – 139MGCAE…PTLKA → MPVDDYWLCLPASCARPFVQ TVRVVQSCPHCCWFPGVLPS VPEPLRMPAMLPTGSHSAVL PPSHCSTAPPSTSQEPSSSA DPKLCLSPPTSDSRQERNVQ FGLA in isoform 6. CuratedAdd BLAST139
Alternative sequenceiVSP_0315601 – 106Missing in isoform 2. CuratedAdd BLAST106
Alternative sequenceiVSP_0315611 – 98Missing in isoform 4. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_0315621 – 51Missing in isoform 3. CuratedAdd BLAST51
Alternative sequenceiVSP_03156352 – 100TADSR…LELDQ → MQQVMLTCKGVNRGHAVPAG PGRKPRPRRSSRLLAGEKHL TRSALLLCH in isoform 3. CuratedAdd BLAST49
Alternative sequenceiVSP_03156499 – 101DQT → MSC in isoform 4. 1 Publication3
Alternative sequenceiVSP_031565107 – 138LEGTL…GPTLK → MLSRLVLNSWAQAIIRPRPP KVLGLQVTTFSE in isoform 2. CuratedAdd BLAST32

Non-standard residue

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the occurrence of non-standard amino acids selenocysteine (Sec) or pyrrolysine (Pyl) in the protein sequence.<p><a href='/help/non_std' target='_top'>More...</a></p>Non-standard residuei648Selenocysteine1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X91247 mRNA Translation: CAA62629.1 Sequence problems.
S79851 mRNA Translation: AAB35418.1 Sequence problems.
D88687 mRNA Translation: BAA13674.1 Sequence problems.
AF077367 mRNA Translation: AAC69621.1 Sequence problems.
AY057105 mRNA Translation: AAL15432.1
AY344081 mRNA Translation: AAQ62461.1
AY344083 mRNA Translation: AAQ62462.1
AY344084 mRNA Translation: AAQ62463.1
AY344086 mRNA Translation: AAQ62464.1
AY344087 mRNA Translation: AAQ62465.1
AY344089 mRNA Translation: AAQ62466.1
AY344092 mRNA Translation: AAQ62467.1
AY344093 mRNA Translation: AAQ62468.1
AY344095 mRNA Translation: AAQ62469.1
AY344096 mRNA Translation: AAQ62470.1
AY344670 mRNA Translation: AAQ62471.1
AY344673 mRNA Translation: AAQ62472.1
AY344679 mRNA Translation: AAQ62473.1
AJ001050 mRNA Translation: CAA04503.1 Sequence problems.
AF208018 mRNA Translation: AAF15900.1 Sequence problems.
AK293322 mRNA Translation: BAH11490.1 Sequence problems.
AK296495 mRNA Translation: BAH12374.1 Sequence problems.
AK304241 mRNA Translation: BAH14140.1 Sequence problems.
CR536506 mRNA Translation: CAG38744.1 Sequence problems.
BT019640 mRNA Translation: AAV38446.1 Sequence problems.
DQ157758 Genomic DNA Translation: AAZ67916.1 Sequence problems.
AC089983 Genomic DNA No translation available.
AC090107 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW97745.1 Sequence problems.
BC018122 mRNA Translation: AAH18122.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS53820.1 [Q16881-1]
CCDS53821.1 [Q16881-4]
CCDS53823.1 [Q16881-5]
CCDS58274.1 [Q16881-7]

Protein sequence database of the Protein Information Resource

More...
PIRi
S66677

NCBI Reference Sequences

More...
RefSeqi
NP_001087240.1, NM_001093771.2 [Q16881-1]
NP_001248374.1, NM_001261445.1
NP_001248375.1, NM_001261446.1 [Q16881-7]
NP_003321.3, NM_003330.3 [Q16881-4]
NP_877393.1, NM_182729.2 [Q16881-5]
NP_877419.1, NM_182742.2 [Q16881-5]
NP_877420.1, NM_182743.2 [Q16881-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000503506; ENSP00000421934; ENSG00000198431 [Q16881-5]
ENST00000524698; ENSP00000433425; ENSG00000198431 [Q16881-5]
ENST00000525566; ENSP00000434516; ENSG00000198431 [Q16881-1]
ENST00000526390; ENSP00000435123; ENSG00000198431 [Q16881-2]
ENST00000526691; ENSP00000435929; ENSG00000198431 [Q16881-4]
ENST00000529546; ENSP00000434919; ENSG00000198431 [Q16881-7]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7296

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7296

UCSC genome browser

More...
UCSCi
uc010swp.4 human [Q16881-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism, Selenocysteine

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X91247 mRNA Translation: CAA62629.1 Sequence problems.
S79851 mRNA Translation: AAB35418.1 Sequence problems.
D88687 mRNA Translation: BAA13674.1 Sequence problems.
AF077367 mRNA Translation: AAC69621.1 Sequence problems.
AY057105 mRNA Translation: AAL15432.1
AY344081 mRNA Translation: AAQ62461.1
AY344083 mRNA Translation: AAQ62462.1
AY344084 mRNA Translation: AAQ62463.1
AY344086 mRNA Translation: AAQ62464.1
AY344087 mRNA Translation: AAQ62465.1
AY344089 mRNA Translation: AAQ62466.1
AY344092 mRNA Translation: AAQ62467.1
AY344093 mRNA Translation: AAQ62468.1
AY344095 mRNA Translation: AAQ62469.1
AY344096 mRNA Translation: AAQ62470.1
AY344670 mRNA Translation: AAQ62471.1
AY344673 mRNA Translation: AAQ62472.1
AY344679 mRNA Translation: AAQ62473.1
AJ001050 mRNA Translation: CAA04503.1 Sequence problems.
AF208018 mRNA Translation: AAF15900.1 Sequence problems.
AK293322 mRNA Translation: BAH11490.1 Sequence problems.
AK296495 mRNA Translation: BAH12374.1 Sequence problems.
AK304241 mRNA Translation: BAH14140.1 Sequence problems.
CR536506 mRNA Translation: CAG38744.1 Sequence problems.
BT019640 mRNA Translation: AAV38446.1 Sequence problems.
DQ157758 Genomic DNA Translation: AAZ67916.1 Sequence problems.
AC089983 Genomic DNA No translation available.
AC090107 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW97745.1 Sequence problems.
BC018122 mRNA Translation: AAH18122.2
CCDSiCCDS53820.1 [Q16881-1]
CCDS53821.1 [Q16881-4]
CCDS53823.1 [Q16881-5]
CCDS58274.1 [Q16881-7]
PIRiS66677
RefSeqiNP_001087240.1, NM_001093771.2 [Q16881-1]
NP_001248374.1, NM_001261445.1
NP_001248375.1, NM_001261446.1 [Q16881-7]
NP_003321.3, NM_003330.3 [Q16881-4]
NP_877393.1, NM_182729.2 [Q16881-5]
NP_877419.1, NM_182742.2 [Q16881-5]
NP_877420.1, NM_182743.2 [Q16881-5]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1W1Cmodel-A/B161-649[»]
2CFYX-ray2.70A/B/C/D/E/F151-647[»]
2J3NX-ray2.80A/B/C/D/E/F151-647[»]
2ZZ0X-ray2.80A/B/C/D150-647[»]
2ZZBX-ray3.20A/B/C/D150-647[»]
2ZZCX-ray2.60A/B/C/D150-647[»]
3QFAX-ray2.20A/B151-649[»]
3QFBX-ray2.60A/B151-649[»]
SMRiQ16881
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi113147, 45 interactors
IntActiQ16881, 14 interactors
MINTiQ16881
STRINGi9606.ENSP00000434516

Chemistry databases

BindingDBiQ16881
ChEMBLiCHEMBL1927
DrugBankiDB01169 Arsenic trioxide
DB03147 Flavin adenine dinucleotide
DB04106 Fotemustine
DB05428 motexafin gadolinium
DB02338 Nadph Dihydro-Nicotinamide-Adenine-Dinucleotidephosphate
DB05448 PX-12
DB11127 Selenious acid
DB11135 Selenium
DB03566 Spermidine
DrugCentraliQ16881

PTM databases

iPTMnetiQ16881
PhosphoSitePlusiQ16881
SwissPalmiQ16881

Polymorphism and mutation databases

BioMutaiTXNRD1
DMDMi172046253

2D gel databases

REPRODUCTION-2DPAGEiIPI00554786

Proteomic databases

EPDiQ16881
jPOSTiQ16881
MassIVEiQ16881
MaxQBiQ16881
PaxDbiQ16881
PeptideAtlasiQ16881
PRIDEiQ16881
ProteomicsDBi22254
27407
61119 [Q16881-1]
61120 [Q16881-2]
61121 [Q16881-3]
61122 [Q16881-4]
61123 [Q16881-5]
61124 [Q16881-6]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
7296

Genome annotation databases

EnsembliENST00000503506; ENSP00000421934; ENSG00000198431 [Q16881-5]
ENST00000524698; ENSP00000433425; ENSG00000198431 [Q16881-5]
ENST00000525566; ENSP00000434516; ENSG00000198431 [Q16881-1]
ENST00000526390; ENSP00000435123; ENSG00000198431 [Q16881-2]
ENST00000526691; ENSP00000435929; ENSG00000198431 [Q16881-4]
ENST00000529546; ENSP00000434919; ENSG00000198431 [Q16881-7]
GeneIDi7296
KEGGihsa:7296
UCSCiuc010swp.4 human [Q16881-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7296
DisGeNETi7296

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TXNRD1
HGNCiHGNC:12437 TXNRD1
HPAiCAB004607
CAB015834
HPA001395
HPA043871
MIMi601112 gene
neXtProtiNX_Q16881
OpenTargetsiENSG00000198431
PharmGKBiPA37093

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1752 Eukaryota
KOG4716 Eukaryota
COG1249 LUCA
GeneTreeiENSGT00940000160180
InParanoidiQ16881
KOiK22182
OrthoDBi581771at2759
PhylomeDBiQ16881
TreeFamiTF314782

Enzyme and pathway databases

BRENDAi1.8.1.9 2681
ReactomeiR-HSA-1989781 PPARA activates gene expression
R-HSA-2408550 Metabolism of ingested H2SeO4 and H2SeO3 into H2Se
R-HSA-3299685 Detoxification of Reactive Oxygen Species
R-HSA-499943 Interconversion of nucleotide di- and triphosphates
R-HSA-5263617 Metabolism of ingested MeSeO2H into MeSeH
R-HSA-5336415 Uptake and function of diphtheria toxin
R-HSA-5628897 TP53 Regulates Metabolic Genes

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TXNRD1 human
EvolutionaryTraceiQ16881

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TXNRD1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7296
PharosiQ16881

Protein Ontology

More...
PROi
PR:Q16881

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000198431 Expressed in 235 organ(s), highest expression level in adrenal tissue
ExpressionAtlasiQ16881 baseline and differential
GenevisibleiQ16881 HS

Family and domain databases

Gene3Di3.30.390.30, 1 hit
3.50.50.60, 2 hits
InterProiView protein in InterPro
IPR036188 FAD/NAD-bd_sf
IPR023753 FAD/NAD-binding_dom
IPR016156 FAD/NAD-linked_Rdtase_dimer_sf
IPR002109 Glutaredoxin
IPR001100 Pyr_nuc-diS_OxRdtase
IPR004099 Pyr_nucl-diS_OxRdtase_dimer
IPR012999 Pyr_OxRdtase_I_AS
IPR036249 Thioredoxin-like_sf
IPR006338 Thioredoxin/glutathione_Rdtase
PfamiView protein in Pfam
PF00462 Glutaredoxin, 1 hit
PF07992 Pyr_redox_2, 1 hit
PF02852 Pyr_redox_dim, 1 hit
PIRSFiPIRSF000350 Mercury_reductase_MerA, 1 hit
SUPFAMiSSF51905 SSF51905, 1 hit
SSF52833 SSF52833, 1 hit
SSF55424 SSF55424, 1 hit
TIGRFAMsiTIGR01438 TGR, 1 hit
PROSITEiView protein in PROSITE
PS51354 GLUTAREDOXIN_2, 1 hit
PS00076 PYRIDINE_REDOX_1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTRXR1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q16881
Secondary accession number(s): B7Z1F4
, B7Z3Y8, B7Z904, E9PMY9, F5H780, Q6FI31, Q6VB40, Q6VB41, Q6VB42, Q6VBP2, Q6VBP3, Q6VBP4, Q6VBP5, Q6VBP9, Q6VBQ0, Q6YNQ1, Q76P53, Q7LA96, Q8WVC8, Q99475, Q9UES8, Q9UH79
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: February 26, 2008
Last modified: October 16, 2019
This is version 215 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again