Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Thioredoxin reductase 1, cytoplasmic

Gene

TXNRD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Isoform 1 may possess glutaredoxin activity as well as thioredoxin reductase activity and induces actin and tubulin polymerization, leading to formation of cell membrane protrusions. Isoform 4 enhances the transcriptional activity of estrogen receptors alpha and beta while isoform 5 enhances the transcriptional activity of the beta receptor only. Isoform 5 also mediates cell death induced by a combination of interferon-beta and retinoic acid.4 Publications

Miscellaneous

The thioredoxin reductase active site is a redox-active disulfide bond. The selenocysteine residue is also essential for catalytic activity.

Catalytic activityi

Thioredoxin + NADP+ = thioredoxin disulfide + NADPH.

Cofactori

FADNote: Binds 1 FAD per subunit.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei622Proton acceptorBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi192 – 209FADBy similarityAdd BLAST18

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionOxidoreductase
Biological processElectron transport, Transport
LigandFAD, Flavoprotein, NADP

Enzyme and pathway databases

BRENDAi1.8.1.9 2681
ReactomeiR-HSA-1989781 PPARA activates gene expression
R-HSA-2408550 Metabolism of ingested H2SeO4 and H2SeO3 into H2Se
R-HSA-3299685 Detoxification of Reactive Oxygen Species
R-HSA-499943 Interconversion of nucleotide di- and triphosphates
R-HSA-5263617 Metabolism of ingested MeSeO2H into MeSeH
R-HSA-5336415 Uptake and function of diphtheria toxin
R-HSA-5628897 TP53 Regulates Metabolic Genes

Names & Taxonomyi

Protein namesi
Recommended name:
Thioredoxin reductase 1, cytoplasmic (EC:1.8.1.9)
Short name:
TR
Alternative name(s):
Gene associated with retinoic and interferon-induced mortality 12 protein
Short name:
GRIM-12
Short name:
Gene associated with retinoic and IFN-induced mortality 12 protein
KM-102-derived reductase-like factor
Thioredoxin reductase TR1
Gene namesi
Name:TXNRD1
Synonyms:GRIM12, KDRF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000198431.15
HGNCiHGNC:12437 TXNRD1
MIMi601112 gene
neXtProtiNX_Q16881

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi7296
OpenTargetsiENSG00000198431
PharmGKBiPA37093

Chemistry databases

ChEMBLiCHEMBL1927
DrugBankiDB01169 Arsenic trioxide
DB03147 Flavin adenine dinucleotide
DB04106 Fotemustine
DB05428 motexafin gadolinium
DB02338 Nadph Dihydro-Nicotinamide-Adenine-Dinucleotidephosphate
DB05448 PX-12
DB03566 Spermidine

Polymorphism and mutation databases

BioMutaiTXNRD1
DMDMi172046253

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000302861 – 649Thioredoxin reductase 1, cytoplasmicAdd BLAST649

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi209 ↔ 214Redox-activeBy similarity
Modified residuei218N6-succinyllysineBy similarity1
Modified residuei281PhosphotyrosineCombined sources1
Cross-linki647 ↔ 648Cysteinyl-selenocysteine (Cys-Sec)By similarity
Isoform 5 (identifier: Q16881-5)
Modified residuei1N-acetylmethionineCombined sources1

Post-translational modificationi

The N-terminus of isoform 5 is blocked.
ISGylated.1 Publication

Keywords - PTMi

Acetylation, Disulfide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ16881
MaxQBiQ16881
PaxDbiQ16881
PeptideAtlasiQ16881
PRIDEiQ16881
ProteomicsDBi61119
61120 [Q16881-2]
61121 [Q16881-3]
61122 [Q16881-4]
61123 [Q16881-5]
61124 [Q16881-6]

2D gel databases

REPRODUCTION-2DPAGEiIPI00554786

PTM databases

iPTMnetiQ16881
PhosphoSitePlusiQ16881
SwissPalmiQ16881

Expressioni

Tissue specificityi

Isoform 1 is expressed predominantly in Leydig cells (at protein level). Also expressed in ovary, spleen, heart, liver, kidney and pancreas and in a number of cancer cell lines. Isoform 4 is widely expressed with highest levels in kidney, testis, uterus, ovary, prostate, placenta and fetal liver.2 Publications

Inductioni

Isoform 5 is induced by a combination of interferon-beta and retinoic acid (at protein level). Isoform 1 is induced by estradiol or testosterone in HeLa cells.1 Publication

Gene expression databases

BgeeiENSG00000198431 Expressed in 235 organ(s), highest expression level in adrenal tissue
ExpressionAtlasiQ16881 baseline and differential
GenevisibleiQ16881 HS

Organism-specific databases

HPAiCAB004607
CAB015834
HPA001395
HPA043871

Interactioni

Subunit structurei

Homodimer. Isoform 4 interacts with ESR1 and ESR2. Interacts with HERC5.2 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi113147, 40 interactors
IntActiQ16881, 9 interactors
MINTiQ16881
STRINGi9606.ENSP00000434516

Chemistry databases

BindingDBiQ16881

Structurei

Secondary structure

1649
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ16881
SMRiQ16881
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ16881

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini56 – 156GlutaredoxinPROSITE-ProRule annotationAdd BLAST101

Domaini

The N-terminal glutaredoxin domain found in isoform 1 does not contain the C-P-Y-C redox-active motif normally found in glutaredoxins and has been found to be inactive in classical glutaredoxin assays.1 Publication

Sequence similaritiesi

Keywords - Domaini

Redox-active center

Phylogenomic databases

eggNOGiKOG1752 Eukaryota
KOG4716 Eukaryota
COG1249 LUCA
GeneTreeiENSGT00390000007578
HOVERGENiHBG004959
InParanoidiQ16881
KOiK22182
OrthoDBiEOG091G03IU
PhylomeDBiQ16881
TreeFamiTF314782

Family and domain databases

Gene3Di3.30.390.30, 1 hit
3.50.50.60, 2 hits
InterProiView protein in InterPro
IPR036188 FAD/NAD-bd_sf
IPR023753 FAD/NAD-binding_dom
IPR016156 FAD/NAD-linked_Rdtase_dimer_sf
IPR002109 Glutaredoxin
IPR001100 Pyr_nuc-diS_OxRdtase
IPR004099 Pyr_nucl-diS_OxRdtase_dimer
IPR012999 Pyr_OxRdtase_I_AS
IPR036249 Thioredoxin-like_sf
IPR006338 Thioredoxin/glutathione_Rdtase
PfamiView protein in Pfam
PF00462 Glutaredoxin, 1 hit
PF07992 Pyr_redox_2, 1 hit
PF02852 Pyr_redox_dim, 1 hit
PIRSFiPIRSF000350 Mercury_reductase_MerA, 1 hit
SUPFAMiSSF51905 SSF51905, 1 hit
SSF52833 SSF52833, 1 hit
SSF55424 SSF55424, 1 hit
TIGRFAMsiTIGR01438 TGR, 1 hit
PROSITEiView protein in PROSITE
PS51354 GLUTAREDOXIN_2, 1 hit
PS00076 PYRIDINE_REDOX_1, 1 hit

Sequences (7+)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 14 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q16881-1) [UniParc]FASTAAdd to basket
Also known as: V, TXNRD1_v3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGCAEGKAVA AAAPTELQTK GKNGDGRRRS AKDHHPGKTL PENPAGFTST
60 70 80 90 100
ATADSRALLQ AYIDGHSVVI FSRSTCTRCT EVKKLFKSLC VPYFVLELDQ
110 120 130 140 150
TEDGRALEGT LSELAAETDL PVVFVKQRKI GGHGPTLKAY QEGRLQKLLK
160 170 180 190 200
MNGPEDLPKS YDYDLIIIGG GSGGLAAAKE AAQYGKKVMV LDFVTPTPLG
210 220 230 240 250
TRWGLGGTCV NVGCIPKKLM HQAALLGQAL QDSRNYGWKV EETVKHDWDR
260 270 280 290 300
MIEAVQNHIG SLNWGYRVAL REKKVVYENA YGQFIGPHRI KATNNKGKEK
310 320 330 340 350
IYSAERFLIA TGERPRYLGI PGDKEYCISS DDLFSLPYCP GKTLVVGASY
360 370 380 390 400
VALECAGFLA GIGLDVTVMV RSILLRGFDQ DMANKIGEHM EEHGIKFIRQ
410 420 430 440 450
FVPIKVEQIE AGTPGRLRVV AQSTNSEEII EGEYNTVMLA IGRDACTRKI
460 470 480 490 500
GLETVGVKIN EKTGKIPVTD EEQTNVPYIY AIGDILEDKV ELTPVAIQAG
510 520 530 540 550
RLLAQRLYAG STVKCDYENV PTTVFTPLEY GACGLSEEKA VEKFGEENIE
560 570 580 590 600
VYHSYFWPLE WTIPSRDNNK CYAKIICNTK DNERVVGFHV LGPNAGEVTQ
610 620 630 640
GFAAALKCGL TKKQLDSTIG IHPVCAEVFT TLSVTKRSGA SILQAGCUG
Note: Minor isoform.
Length:649
Mass (Da):70,906
Last modified:February 26, 2008 - v3
Checksum:i5A51C3F77EB03EFE
GO
Isoform 2 (identifier: Q16881-2) [UniParc]FASTAAdd to basket
Also known as: II, TXNRD1_v4

The sequence of this isoform differs from the canonical sequence as follows:
     1-106: Missing.
     107-138: LEGTLSELAAETDLPVVFVKQRKIGGHGPTLK → MLSRLVLNSWAQAIIRPRPPKVLGLQVTTFSE

Show »
Length:543
Mass (Da):59,787
Checksum:i990DB8D334659B4D
GO
Isoform 3 (identifier: Q16881-3) [UniParc]FASTAAdd to basket
Also known as: III, TXNRD1_v5

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.
     52-100: TADSRALLQA...VPYFVLELDQ → MQQVMLTCKG...LTRSALLLCH

Show »
Length:598
Mass (Da):65,567
Checksum:i81F496F5BB85A49E
GO
Isoform 4 (identifier: Q16881-4) [UniParc]FASTAAdd to basket
Also known as: IV, TXNRD1_v2, TrxR1b

The sequence of this isoform differs from the canonical sequence as follows:
     1-98: Missing.
     99-101: DQT → MSC

Show »
Length:551
Mass (Da):60,419
Checksum:iF54B034AADF51E5B
GO
Isoform 5 (identifier: Q16881-5) [UniParc]FASTAAdd to basket
Also known as: I, TXNRD1_v1, TrxR1a

The sequence of this isoform differs from the canonical sequence as follows:
     1-150: Missing.

Note: Major isoform. The N-terminus of the sequence is processed into a mature form that lacks residues Met-151 and Asn-152 at the N-terminus.Combined sources
Show »
Length:499
Mass (Da):54,754
Checksum:iC24BAEB4A573EABE
GO
Isoform 6 (identifier: Q16881-6) [UniParc]FASTAAdd to basket
Also known as: VI

The sequence of this isoform differs from the canonical sequence as follows:
     1-139: MGCAEGKAVA...IGGHGPTLKA → MPVDDYWLCL...QERNVQFGLA

Show »
Length:614
Mass (Da):67,266
Checksum:i9C635E1C6EA94934
GO
Isoform 7 (identifier: Q16881-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-188: Missing.

Note: No experimental confirmation.
Show »
Length:461
Mass (Da):50,873
Checksum:i07D3A620A6BD82EA
GO

Computationally mapped potential isoform sequencesi

There are 14 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WSW9A0A087WSW9_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
548Annotation score:
A0A087WSY9A0A087WSY9_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
648Annotation score:
E2QRB9E2QRB9_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
460Annotation score:
F8W809F8W809_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
498Annotation score:
A0A182DWI3A0A182DWI3_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
568Annotation score:
E9PIR7E9PIR7_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
482Annotation score:
E9PKI4E9PKI4_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
72Annotation score:
E9PKD3E9PKD3_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
175Annotation score:
E9PLT3E9PLT3_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
70Annotation score:
E9PIZ5E9PIZ5_HUMAN
Thioredoxin reductase 1, cytoplasmi...
TXNRD1
139Annotation score:
There are more potential isoformsShow all

Sequence cautioni

The sequence AAB35418 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec.Curated
The sequence AAC69621 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec.Curated
The sequence AAF15900 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec.Curated
The sequence AAV38446 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec.Curated
The sequence AAZ67916 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec.Curated
The sequence BAA13674 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec.Curated
The sequence BAH11490 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec.Curated
The sequence BAH12374 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec.Curated
The sequence BAH14140 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec.Curated
The sequence CAA04503 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec.Curated
The sequence CAA62629 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec.Curated
The sequence CAG38744 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec.Curated
The sequence EAW97745 differs from that shown. Reason: Erroneous termination at position 648. Translated as Sec.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti153G → S in AAQ62473 (PubMed:14980707).Curated1
Sequence conflicti181A → P in AAF15900 (Ref. 6) Curated1
Sequence conflicti194V → G in AAF15900 (Ref. 6) Curated1
Sequence conflicti200G → E in AAQ62469 (PubMed:14980707).Curated1
Sequence conflicti202R → K in AAQ62463 (PubMed:14980707).Curated1
Sequence conflicti215I → N in AAQ62463 (PubMed:14980707).Curated1
Sequence conflicti297G → D in BAH11490 (PubMed:14702039).Curated1
Sequence conflicti306R → S in AAB35418 (PubMed:7589432).Curated1
Sequence conflicti306R → S in CAA62629 (PubMed:7589432).Curated1
Sequence conflicti306R → S in AAL15432 (PubMed:14980707).Curated1
Sequence conflicti365D → N in AAC69621 (PubMed:9774665).Curated1
Sequence conflicti437V → A in BAH12374 (PubMed:14702039).Curated1
Sequence conflicti441I → M in BAH12374 (PubMed:14702039).Curated1
Sequence conflicti449K → R in CAG38744 (Ref. 8) Curated1
Sequence conflicti641S → R in AAC69621 (PubMed:9774665).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051776365D → G2 PublicationsCorresponds to variant dbSNP:rs1127954Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0538191 – 188Missing in isoform 7. 1 PublicationAdd BLAST188
Alternative sequenceiVSP_0315581 – 150Missing in isoform 5. 7 PublicationsAdd BLAST150
Alternative sequenceiVSP_0315591 – 139MGCAE…PTLKA → MPVDDYWLCLPASCARPFVQ TVRVVQSCPHCCWFPGVLPS VPEPLRMPAMLPTGSHSAVL PPSHCSTAPPSTSQEPSSSA DPKLCLSPPTSDSRQERNVQ FGLA in isoform 6. CuratedAdd BLAST139
Alternative sequenceiVSP_0315601 – 106Missing in isoform 2. CuratedAdd BLAST106
Alternative sequenceiVSP_0315611 – 98Missing in isoform 4. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_0315621 – 51Missing in isoform 3. CuratedAdd BLAST51
Alternative sequenceiVSP_03156352 – 100TADSR…LELDQ → MQQVMLTCKGVNRGHAVPAG PGRKPRPRRSSRLLAGEKHL TRSALLLCH in isoform 3. CuratedAdd BLAST49
Alternative sequenceiVSP_03156499 – 101DQT → MSC in isoform 4. 1 Publication3
Alternative sequenceiVSP_031565107 – 138LEGTL…GPTLK → MLSRLVLNSWAQAIIRPRPP KVLGLQVTTFSE in isoform 2. CuratedAdd BLAST32

Non-standard residue

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Non-standard residuei648Selenocysteine1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X91247 mRNA Translation: CAA62629.1 Sequence problems.
S79851 mRNA Translation: AAB35418.1 Sequence problems.
D88687 mRNA Translation: BAA13674.1 Sequence problems.
AF077367 mRNA Translation: AAC69621.1 Sequence problems.
AY057105 mRNA Translation: AAL15432.1
AY344081 mRNA Translation: AAQ62461.1
AY344083 mRNA Translation: AAQ62462.1
AY344084 mRNA Translation: AAQ62463.1
AY344086 mRNA Translation: AAQ62464.1
AY344087 mRNA Translation: AAQ62465.1
AY344089 mRNA Translation: AAQ62466.1
AY344092 mRNA Translation: AAQ62467.1
AY344093 mRNA Translation: AAQ62468.1
AY344095 mRNA Translation: AAQ62469.1
AY344096 mRNA Translation: AAQ62470.1
AY344670 mRNA Translation: AAQ62471.1
AY344673 mRNA Translation: AAQ62472.1
AY344679 mRNA Translation: AAQ62473.1
AJ001050 mRNA Translation: CAA04503.1 Sequence problems.
AF208018 mRNA Translation: AAF15900.1 Sequence problems.
AK293322 mRNA Translation: BAH11490.1 Sequence problems.
AK296495 mRNA Translation: BAH12374.1 Sequence problems.
AK304241 mRNA Translation: BAH14140.1 Sequence problems.
CR536506 mRNA Translation: CAG38744.1 Sequence problems.
BT019640 mRNA Translation: AAV38446.1 Sequence problems.
DQ157758 Genomic DNA Translation: AAZ67916.1 Sequence problems.
AC089983 Genomic DNA No translation available.
AC090107 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW97745.1 Sequence problems.
BC018122 mRNA Translation: AAH18122.2
CCDSiCCDS53820.1 [Q16881-1]
CCDS53821.1 [Q16881-4]
CCDS53823.1 [Q16881-5]
CCDS58274.1 [Q16881-7]
PIRiS66677
RefSeqiNP_001087240.1, NM_001093771.2 [Q16881-1]
NP_001248374.1, NM_001261445.1
NP_001248375.1, NM_001261446.1 [Q16881-7]
NP_003321.3, NM_003330.3 [Q16881-4]
NP_877393.1, NM_182729.2 [Q16881-5]
NP_877419.1, NM_182742.2 [Q16881-5]
NP_877420.1, NM_182743.2 [Q16881-5]
UniGeneiHs.654922
Hs.690011

Genome annotation databases

EnsembliENST00000503506; ENSP00000421934; ENSG00000198431 [Q16881-5]
ENST00000524698; ENSP00000433425; ENSG00000198431 [Q16881-5]
ENST00000525566; ENSP00000434516; ENSG00000198431 [Q16881-1]
ENST00000526390; ENSP00000435123; ENSG00000198431 [Q16881-2]
ENST00000526691; ENSP00000435929; ENSG00000198431 [Q16881-4]
ENST00000529546; ENSP00000434919; ENSG00000198431 [Q16881-7]
GeneIDi7296
KEGGihsa:7296
UCSCiuc010swp.4 human [Q16881-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism, Selenocysteine

Similar proteinsi

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X91247 mRNA Translation: CAA62629.1 Sequence problems.
S79851 mRNA Translation: AAB35418.1 Sequence problems.
D88687 mRNA Translation: BAA13674.1 Sequence problems.
AF077367 mRNA Translation: AAC69621.1 Sequence problems.
AY057105 mRNA Translation: AAL15432.1
AY344081 mRNA Translation: AAQ62461.1
AY344083 mRNA Translation: AAQ62462.1
AY344084 mRNA Translation: AAQ62463.1
AY344086 mRNA Translation: AAQ62464.1
AY344087 mRNA Translation: AAQ62465.1
AY344089 mRNA Translation: AAQ62466.1
AY344092 mRNA Translation: AAQ62467.1
AY344093 mRNA Translation: AAQ62468.1
AY344095 mRNA Translation: AAQ62469.1
AY344096 mRNA Translation: AAQ62470.1
AY344670 mRNA Translation: AAQ62471.1
AY344673 mRNA Translation: AAQ62472.1
AY344679 mRNA Translation: AAQ62473.1
AJ001050 mRNA Translation: CAA04503.1 Sequence problems.
AF208018 mRNA Translation: AAF15900.1 Sequence problems.
AK293322 mRNA Translation: BAH11490.1 Sequence problems.
AK296495 mRNA Translation: BAH12374.1 Sequence problems.
AK304241 mRNA Translation: BAH14140.1 Sequence problems.
CR536506 mRNA Translation: CAG38744.1 Sequence problems.
BT019640 mRNA Translation: AAV38446.1 Sequence problems.
DQ157758 Genomic DNA Translation: AAZ67916.1 Sequence problems.
AC089983 Genomic DNA No translation available.
AC090107 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW97745.1 Sequence problems.
BC018122 mRNA Translation: AAH18122.2
CCDSiCCDS53820.1 [Q16881-1]
CCDS53821.1 [Q16881-4]
CCDS53823.1 [Q16881-5]
CCDS58274.1 [Q16881-7]
PIRiS66677
RefSeqiNP_001087240.1, NM_001093771.2 [Q16881-1]
NP_001248374.1, NM_001261445.1
NP_001248375.1, NM_001261446.1 [Q16881-7]
NP_003321.3, NM_003330.3 [Q16881-4]
NP_877393.1, NM_182729.2 [Q16881-5]
NP_877419.1, NM_182742.2 [Q16881-5]
NP_877420.1, NM_182743.2 [Q16881-5]
UniGeneiHs.654922
Hs.690011

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1W1Cmodel-A/B161-649[»]
2CFYX-ray2.70A/B/C/D/E/F151-647[»]
2J3NX-ray2.80A/B/C/D/E/F151-647[»]
2ZZ0X-ray2.80A/B/C/D150-647[»]
2ZZBX-ray3.20A/B/C/D150-647[»]
2ZZCX-ray2.60A/B/C/D150-647[»]
3QFAX-ray2.20A/B151-649[»]
3QFBX-ray2.60A/B151-649[»]
ProteinModelPortaliQ16881
SMRiQ16881
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113147, 40 interactors
IntActiQ16881, 9 interactors
MINTiQ16881
STRINGi9606.ENSP00000434516

Chemistry databases

BindingDBiQ16881
ChEMBLiCHEMBL1927
DrugBankiDB01169 Arsenic trioxide
DB03147 Flavin adenine dinucleotide
DB04106 Fotemustine
DB05428 motexafin gadolinium
DB02338 Nadph Dihydro-Nicotinamide-Adenine-Dinucleotidephosphate
DB05448 PX-12
DB03566 Spermidine

PTM databases

iPTMnetiQ16881
PhosphoSitePlusiQ16881
SwissPalmiQ16881

Polymorphism and mutation databases

BioMutaiTXNRD1
DMDMi172046253

2D gel databases

REPRODUCTION-2DPAGEiIPI00554786

Proteomic databases

EPDiQ16881
MaxQBiQ16881
PaxDbiQ16881
PeptideAtlasiQ16881
PRIDEiQ16881
ProteomicsDBi61119
61120 [Q16881-2]
61121 [Q16881-3]
61122 [Q16881-4]
61123 [Q16881-5]
61124 [Q16881-6]

Protocols and materials databases

DNASUi7296
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000503506; ENSP00000421934; ENSG00000198431 [Q16881-5]
ENST00000524698; ENSP00000433425; ENSG00000198431 [Q16881-5]
ENST00000525566; ENSP00000434516; ENSG00000198431 [Q16881-1]
ENST00000526390; ENSP00000435123; ENSG00000198431 [Q16881-2]
ENST00000526691; ENSP00000435929; ENSG00000198431 [Q16881-4]
ENST00000529546; ENSP00000434919; ENSG00000198431 [Q16881-7]
GeneIDi7296
KEGGihsa:7296
UCSCiuc010swp.4 human [Q16881-1]

Organism-specific databases

CTDi7296
DisGeNETi7296
EuPathDBiHostDB:ENSG00000198431.15
GeneCardsiTXNRD1
H-InvDBiHIX0010939
HGNCiHGNC:12437 TXNRD1
HPAiCAB004607
CAB015834
HPA001395
HPA043871
MIMi601112 gene
neXtProtiNX_Q16881
OpenTargetsiENSG00000198431
PharmGKBiPA37093
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1752 Eukaryota
KOG4716 Eukaryota
COG1249 LUCA
GeneTreeiENSGT00390000007578
HOVERGENiHBG004959
InParanoidiQ16881
KOiK22182
OrthoDBiEOG091G03IU
PhylomeDBiQ16881
TreeFamiTF314782

Enzyme and pathway databases

BRENDAi1.8.1.9 2681
ReactomeiR-HSA-1989781 PPARA activates gene expression
R-HSA-2408550 Metabolism of ingested H2SeO4 and H2SeO3 into H2Se
R-HSA-3299685 Detoxification of Reactive Oxygen Species
R-HSA-499943 Interconversion of nucleotide di- and triphosphates
R-HSA-5263617 Metabolism of ingested MeSeO2H into MeSeH
R-HSA-5336415 Uptake and function of diphtheria toxin
R-HSA-5628897 TP53 Regulates Metabolic Genes

Miscellaneous databases

ChiTaRSiTXNRD1 human
EvolutionaryTraceiQ16881
GeneWikiiTXNRD1
GenomeRNAii7296
PROiPR:Q16881
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000198431 Expressed in 235 organ(s), highest expression level in adrenal tissue
ExpressionAtlasiQ16881 baseline and differential
GenevisibleiQ16881 HS

Family and domain databases

Gene3Di3.30.390.30, 1 hit
3.50.50.60, 2 hits
InterProiView protein in InterPro
IPR036188 FAD/NAD-bd_sf
IPR023753 FAD/NAD-binding_dom
IPR016156 FAD/NAD-linked_Rdtase_dimer_sf
IPR002109 Glutaredoxin
IPR001100 Pyr_nuc-diS_OxRdtase
IPR004099 Pyr_nucl-diS_OxRdtase_dimer
IPR012999 Pyr_OxRdtase_I_AS
IPR036249 Thioredoxin-like_sf
IPR006338 Thioredoxin/glutathione_Rdtase
PfamiView protein in Pfam
PF00462 Glutaredoxin, 1 hit
PF07992 Pyr_redox_2, 1 hit
PF02852 Pyr_redox_dim, 1 hit
PIRSFiPIRSF000350 Mercury_reductase_MerA, 1 hit
SUPFAMiSSF51905 SSF51905, 1 hit
SSF52833 SSF52833, 1 hit
SSF55424 SSF55424, 1 hit
TIGRFAMsiTIGR01438 TGR, 1 hit
PROSITEiView protein in PROSITE
PS51354 GLUTAREDOXIN_2, 1 hit
PS00076 PYRIDINE_REDOX_1, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTRXR1_HUMAN
AccessioniPrimary (citable) accession number: Q16881
Secondary accession number(s): B7Z1F4
, B7Z3Y8, B7Z904, E9PMY9, F5H780, Q6FI31, Q6VB40, Q6VB41, Q6VB42, Q6VBP2, Q6VBP3, Q6VBP4, Q6VBP5, Q6VBP9, Q6VBQ0, Q6YNQ1, Q76P53, Q7LA96, Q8WVC8, Q99475, Q9UES8, Q9UH79
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: February 26, 2008
Last modified: November 7, 2018
This is version 208 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again