Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3

Gene

PFKFB3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Synthesis and degradation of fructose 2,6-bisphosphate.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei75Fructose 6-phosphate1 Publication1
Binding sitei99Fructose 6-phosphate1 Publication1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei125Sequence analysis1
Binding sitei127Fructose 6-phosphate1 Publication1
Binding sitei133Fructose 6-phosphate1 Publication1
Active sitei155Sequence analysis1
Binding sitei169Fructose 6-phosphate1 Publication1
Binding sitei190Fructose 6-phosphate1 Publication1
Binding sitei194Fructose 6-phosphate1 Publication1
Binding sitei253Fructose 2,6-bisphosphate1 Publication1
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei253Transition state stabilizer1 Publication1
Active sitei254Tele-phosphohistidine intermediate1 Publication1
Binding sitei260Fructose 2,6-bisphosphate1 Publication1
Sitei260Transition state stabilizer1 Publication1
Binding sitei266Fructose 2,6-bisphosphate; via amide nitrogen1 Publication1
Active sitei323Proton donor/acceptor1 Publication1
Binding sitei334Fructose 2,6-bisphosphate1 Publication1
Binding sitei348Fructose 2,6-bisphosphate1 Publication1
Binding sitei352Fructose 2,6-bisphosphate1 Publication1
Binding sitei363Fructose 2,6-bisphosphate1 Publication1
Sitei388Transition state stabilizer1 Publication1
Binding sitei389Fructose 2,6-bisphosphate1 Publication1
Binding sitei393Fructose 2,6-bisphosphateBy similarity1
Binding sitei425ATP3 Publications1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi42 – 50ATP3 Publications9
Nucleotide bindingi164 – 169ATP3 Publications6
Nucleotide bindingi345 – 348ATPBy similarity4
Nucleotide bindingi389 – 393ATPBy similarity5

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Kinase, Multifunctional enzyme, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...
BioCyci
MetaCyc:HS10144-MONOMER

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.7.1.105 2681
3.1.3.46 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-70171 Glycolysis

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
Q16875

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q16875

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3
Short name:
6PF-2-K/Fru-2,6-P2ase 3
Short name:
PFK/FBPase 3
Alternative name(s):
6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme
Renal carcinoma antigen NY-REN-56
iPFK-2
Including the following 2 domains:
Fructose-2,6-bisphosphatase (EC:3.1.3.46)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PFKFB3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000170525.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8874 PFKFB3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605319 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q16875

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
5209

Open Targets

More...
OpenTargetsi
ENSG00000170525

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33213

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2331053

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2937

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PFKFB3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
3023733

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001799681 – 5206-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3Add BLAST520

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei461Phosphoserine; by AMPKCombined sources1 Publication1
Modified residuei463PhosphothreonineCombined sources1
Modified residuei467PhosphoserineCombined sources1
Modified residuei471Phosphothreonine; by PKCBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation by AMPK stimulates activity.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q16875

PeptideAtlas

More...
PeptideAtlasi
Q16875

PRoteomics IDEntifications database

More...
PRIDEi
Q16875

ProteomicsDB human proteome resource

More...
ProteomicsDBi
61114
61115 [Q16875-2]

PTM databases

DEPOD human dephosphorylation database

More...
DEPODi
Q16875

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q16875

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q16875

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000170525 Expressed in 224 organ(s), highest expression level in oviduct epithelium

CleanEx database of gene expression profiles

More...
CleanExi
HS_PFKFB3

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q16875 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q16875 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB020795
HPA008266
HPA043889

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111230, 20 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-1995 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 complex

Database of interacting proteins

More...
DIPi
DIP-33964N

Protein interaction database and analysis system

More...
IntActi
Q16875, 6 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000369100

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q16875

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1520
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q16875

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q16875

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q16875

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 2456-phosphofructo-2-kinaseAdd BLAST245
Regioni246 – 520Fructose-2,6-bisphosphataseAdd BLAST275

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

In the C-terminal section; belongs to the phosphoglycerate mutase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0234 Eukaryota
COG0406 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153570

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000181112

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG005628

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q16875

KEGG Orthology (KO)

More...
KOi
K01103

Identification of Orthologs from Complete Genome Data

More...
OMAi
HDSCEWL

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0A43

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q16875

TreeFam database of animal gene trees

More...
TreeFami
TF313541

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07067 HP_PGM_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.1240, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003094 6Pfruct_kin
IPR013079 6Phosfructo_kin
IPR013078 His_Pase_superF_clade-1
IPR029033 His_PPase_superfam
IPR027417 P-loop_NTPase
IPR001345 PG/BPGM_mutase_AS

The PANTHER Classification System

More...
PANTHERi
PTHR10606 PTHR10606, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01591 6PF2K, 1 hit
PF00300 His_Phos_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00991 6PFRUCTKNASE

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00855 PGAM, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 1 hit
SSF53254 SSF53254, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00175 PG_MUTASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q16875-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPLELTQSRV QKIWVPVDHR PSLPRSCGPK LTNSPTVIVM VGLPARGKTY
60 70 80 90 100
ISKKLTRYLN WIGVPTKVFN VGEYRREAVK QYSSYNFFRP DNEEAMKVRK
110 120 130 140 150
QCALAALRDV KSYLAKEGGQ IAVFDATNTT RERRHMILHF AKENDFKAFF
160 170 180 190 200
IESVCDDPTV VASNIMEVKI SSPDYKDCNS AEAMDDFMKR ISCYEASYQP
210 220 230 240 250
LDPDKCDRDL SLIKVIDVGR RFLVNRVQDH IQSRIVYYLM NIHVQPRTIY
260 270 280 290 300
LCRHGENEHN LQGRIGGDSG LSSRGKKFAS ALSKFVEEQN LKDLRVWTSQ
310 320 330 340 350
LKSTIQTAEA LRLPYEQWKA LNEIDAGVCE ELTYEEIRDT YPEEYALREQ
360 370 380 390 400
DKYYYRYPTG ESYQDLVQRL EPVIMELERQ ENVLVICHQA VLRCLLAYFL
410 420 430 440 450
DKSAEEMPYL KCPLHTVLKL TPVAYGCRVE SIYLNVESVC THRERSEDAK
460 470 480 490 500
KGPNPLMRRN SVTPLASPEP TKKPRINSFE EHVASTSAAL PSCLPPEVPT
510 520
QLPGQNMKGS RSSADSSRKH
Length:520
Mass (Da):59,609
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA7675A4ADC376879
GO
Isoform 2 (identifier: Q16875-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     506-520: NMKGSRSSADSSRKH → PLLGQACLT

Show »
Length:514
Mass (Da):58,876
Checksum:i18FD1D267306853D
GO
Isoform 3 (identifier: Q16875-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MPLELTQSRVQKIWVPVDHRPSLPRS → MPFRKA

Note: Gene prediction based on EST data.
Show »
Length:500
Mass (Da):57,287
Checksum:i32D2924D3D207C17
GO
Isoform 4 (identifier: Q16875-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: MPLELTQSRVQKIWVPVDHRPSLPRS → MGEGGQKEGDSQQAGALPLLCQLDTFSPKATVFGVSINPA

Note: No experimental confirmation available.
Show »
Length:534
Mass (Da):60,602
Checksum:iFB3222408A8BC7EE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5VX20Q5VX20_HUMAN
6-phosphofructo-2-kinase/fructose-2...
PFKFB3
526Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5W015Q5W015_HUMAN
6-phosphofructo-2-kinase/fructose-2...
PFKFB3
513Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z2I2F2Z2I2_HUMAN
6-phosphofructo-2-kinase/fructose-2...
PFKFB3
455Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q9H178Q9H178_HUMAN
6-phosphofructo-2-kinase/fructose-2...
PFKFB3
92Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2PR17A0A1W2PR17_HUMAN
6-phosphofructo-2-kinase/fructose-2...
PFKFB3
568Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2PNV9A0A1W2PNV9_HUMAN
6-phosphofructo-2-kinase/fructose-2...
PFKFB3
122Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y483H0Y483_HUMAN
6-phosphofructo-2-kinase/fructose-2...
PFKFB3
143Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q9BQU1Q9BQU1_HUMAN
6-phosphofructo-2-kinase/ fructose-...
PFKFB3
31Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YDV0H0YDV0_HUMAN
6-phosphofructo-2-kinase/fructose-2...
PFKFB3
61Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti136M → V in AAB99795 (Ref. 4) Curated1
Sequence conflicti141A → G in AAC62000 (PubMed:10077634).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0471651 – 26MPLEL…SLPRS → MPFRKA in isoform 3. CuratedAdd BLAST26
Alternative sequenceiVSP_0545491 – 26MPLEL…SLPRS → MGEGGQKEGDSQQAGALPLL CQLDTFSPKATVFGVSINPA in isoform 4. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_004680506 – 520NMKGS…SSRKH → PLLGQACLT in isoform 2. 1 PublicationAdd BLAST15

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D49817 mRNA Translation: BAA08624.1
L77662 mRNA Translation: AAL40083.1
AF109735 mRNA Translation: AAD08818.1
AF041831
, AF041823, AF041824, AF041825, AF041826, AF041827, AF041828, AF041829, AF041830 Genomic DNA Translation: AAB99795.1
AF056320 mRNA Translation: AAC62000.1
AK291263 mRNA Translation: BAF83952.1
AK304450 mRNA Translation: BAH14191.1
AL359960 Genomic DNA No translation available.
AL157395 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW86398.1
CH471072 Genomic DNA Translation: EAW86399.1
BC040482 mRNA Translation: AAH40482.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44353.1 [Q16875-3]
CCDS60479.1 [Q16875-4]
CCDS7078.1 [Q16875-1]
CCDS81439.1 [Q16875-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
JC4626

NCBI Reference Sequences

More...
RefSeqi
NP_001269559.1, NM_001282630.2 [Q16875-4]
NP_001300992.1, NM_001314063.1 [Q16875-2]
NP_004557.1, NM_004566.3 [Q16875-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.195471

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000360521; ENSP00000353712; ENSG00000170525 [Q16875-2]
ENST00000379775; ENSP00000369100; ENSG00000170525 [Q16875-1]
ENST00000379789; ENSP00000369115; ENSG00000170525 [Q16875-3]
ENST00000536985; ENSP00000443319; ENSG00000170525 [Q16875-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5209

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5209

UCSC genome browser

More...
UCSCi
uc001ijd.4 human [Q16875-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D49817 mRNA Translation: BAA08624.1
L77662 mRNA Translation: AAL40083.1
AF109735 mRNA Translation: AAD08818.1
AF041831
, AF041823, AF041824, AF041825, AF041826, AF041827, AF041828, AF041829, AF041830 Genomic DNA Translation: AAB99795.1
AF056320 mRNA Translation: AAC62000.1
AK291263 mRNA Translation: BAF83952.1
AK304450 mRNA Translation: BAH14191.1
AL359960 Genomic DNA No translation available.
AL157395 Genomic DNA No translation available.
CH471072 Genomic DNA Translation: EAW86398.1
CH471072 Genomic DNA Translation: EAW86399.1
BC040482 mRNA Translation: AAH40482.1
CCDSiCCDS44353.1 [Q16875-3]
CCDS60479.1 [Q16875-4]
CCDS7078.1 [Q16875-1]
CCDS81439.1 [Q16875-2]
PIRiJC4626
RefSeqiNP_001269559.1, NM_001282630.2 [Q16875-4]
NP_001300992.1, NM_001314063.1 [Q16875-2]
NP_004557.1, NM_004566.3 [Q16875-1]
UniGeneiHs.195471

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2AXNX-ray2.10A1-520[»]
2DWOX-ray2.25A1-520[»]
2DWPX-ray2.70A1-520[»]
2I1VX-ray2.50B1-520[»]
3QPUX-ray2.30A1-520[»]
3QPVX-ray2.50A1-520[»]
3QPWX-ray2.25A1-520[»]
4D4JX-ray3.00A1-449[»]
4D4KX-ray3.24A1-449[»]
4D4LX-ray3.16A1-449[»]
4D4MX-ray2.32A1-449[»]
4MA4X-ray2.23A1-520[»]
5AJVX-ray3.01B1-520[»]
5AJWX-ray2.50A1-520[»]
5AJXX-ray2.58A1-520[»]
5AJYX-ray2.37A1-520[»]
5AJZX-ray2.35A1-520[»]
5AK0X-ray2.03A1-520[»]
ProteinModelPortaliQ16875
SMRiQ16875
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111230, 20 interactors
ComplexPortaliCPX-1995 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 complex
DIPiDIP-33964N
IntActiQ16875, 6 interactors
STRINGi9606.ENSP00000369100

Chemistry databases

BindingDBiQ16875
ChEMBLiCHEMBL2331053
GuidetoPHARMACOLOGYi2937

PTM databases

DEPODiQ16875
iPTMnetiQ16875
PhosphoSitePlusiQ16875

Polymorphism and mutation databases

BioMutaiPFKFB3
DMDMi3023733

Proteomic databases

PaxDbiQ16875
PeptideAtlasiQ16875
PRIDEiQ16875
ProteomicsDBi61114
61115 [Q16875-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
5209
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000360521; ENSP00000353712; ENSG00000170525 [Q16875-2]
ENST00000379775; ENSP00000369100; ENSG00000170525 [Q16875-1]
ENST00000379789; ENSP00000369115; ENSG00000170525 [Q16875-3]
ENST00000536985; ENSP00000443319; ENSG00000170525 [Q16875-4]
GeneIDi5209
KEGGihsa:5209
UCSCiuc001ijd.4 human [Q16875-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5209
DisGeNETi5209
EuPathDBiHostDB:ENSG00000170525.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PFKFB3
HGNCiHGNC:8874 PFKFB3
HPAiCAB020795
HPA008266
HPA043889
MIMi605319 gene
neXtProtiNX_Q16875
OpenTargetsiENSG00000170525
PharmGKBiPA33213

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0234 Eukaryota
COG0406 LUCA
GeneTreeiENSGT00940000153570
HOGENOMiHOG000181112
HOVERGENiHBG005628
InParanoidiQ16875
KOiK01103
OMAiHDSCEWL
OrthoDBiEOG091G0A43
PhylomeDBiQ16875
TreeFamiTF313541

Enzyme and pathway databases

BioCyciMetaCyc:HS10144-MONOMER
BRENDAi2.7.1.105 2681
3.1.3.46 2681
ReactomeiR-HSA-70171 Glycolysis
SABIO-RKiQ16875
SIGNORiQ16875

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PFKFB3 human
EvolutionaryTraceiQ16875

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PFKFB3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5209

Protein Ontology

More...
PROi
PR:Q16875

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000170525 Expressed in 224 organ(s), highest expression level in oviduct epithelium
CleanExiHS_PFKFB3
ExpressionAtlasiQ16875 baseline and differential
GenevisibleiQ16875 HS

Family and domain databases

CDDicd07067 HP_PGM_like, 1 hit
Gene3Di3.40.50.1240, 1 hit
InterProiView protein in InterPro
IPR003094 6Pfruct_kin
IPR013079 6Phosfructo_kin
IPR013078 His_Pase_superF_clade-1
IPR029033 His_PPase_superfam
IPR027417 P-loop_NTPase
IPR001345 PG/BPGM_mutase_AS
PANTHERiPTHR10606 PTHR10606, 1 hit
PfamiView protein in Pfam
PF01591 6PF2K, 1 hit
PF00300 His_Phos_1, 1 hit
PRINTSiPR00991 6PFRUCTKNASE
SMARTiView protein in SMART
SM00855 PGAM, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
SSF53254 SSF53254, 1 hit
PROSITEiView protein in PROSITE
PS00175 PG_MUTASE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiF263_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q16875
Secondary accession number(s): B7Z955
, O43622, O75902, Q5VX15, Q5VX18, Q5VX19
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: December 5, 2018
This is version 191 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again