Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 171 (11 Dec 2019)
Sequence version 2 (25 Nov 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

NADP-dependent malic enzyme, mitochondrial

Gene

ME3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+By similarity, Mn2+By similarityNote: Divalent metal cations. Prefers magnesium or manganese.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei137Proton donorBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei190NADBy similarity1
Active sitei208Proton acceptorBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi280Divalent metal cationBy similarity1
Metal bindingi281Divalent metal cationBy similarity1
Metal bindingi304Divalent metal cationBy similarity1
Binding sitei304NADBy similarity1
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei304Important for activityBy similarity1
Binding sitei443NADBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionOxidoreductase
LigandMetal-binding, NADP

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-71403 Citric acid cycle (TCA cycle)

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
Q16798

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NADP-dependent malic enzyme, mitochondrial (EC:1.1.1.40)
Short name:
NADP-ME
Alternative name(s):
Malic enzyme 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ME3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000151376.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6985 ME3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604626 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q16798

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000151376

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30725

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q16798 Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL6182

Drug and drug target database

More...
DrugBanki
DB00157 NADH
DB03680 Tartronate

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ME3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
215274021

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – ?MitochondrionSequence analysis
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000018539? – 604NADP-dependent malic enzyme, mitochondrial

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei371PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q16798

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q16798

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q16798

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q16798

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q16798

PeptideAtlas

More...
PeptideAtlasi
Q16798

PRoteomics IDEntifications database

More...
PRIDEi
Q16798

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
61073 [Q16798-1]
6809

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q16798

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q16798

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed predominantly in organs with a low-division rate.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000151376 Expressed in 211 organ(s), highest expression level in caudate nucleus

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q16798 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q16798 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA038473

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116081, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000440246

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q16798 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q16798

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the malic enzymes family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1257 Eukaryota
COG0281 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183134

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000042486

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q16798

KEGG Orthology (KO)

More...
KOi
K00029

Identification of Orthologs from Complete Genome Data

More...
OMAi
WIREQMW

Database of Orthologous Groups

More...
OrthoDBi
435571at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q16798

TreeFam database of animal gene trees

More...
TreeFami
TF300537

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.10380, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR015884 Malic_enzyme_CS
IPR012301 Malic_N_dom
IPR037062 Malic_N_dom_sf
IPR012302 Malic_NAD-bd
IPR001891 Malic_OxRdtase
IPR036291 NAD(P)-bd_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00390 malic, 1 hit
PF03949 Malic_M, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF000106 ME, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00072 MALOXRDTASE

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01274 malic, 1 hit
SM00919 Malic_M, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51735 SSF51735, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00331 MALIC_ENZYMES, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q16798-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGAALGTGTR LAPWPGRACG ALPRWTPTAP AQGCHSKPGP ARPVPLKKRG
60 70 80 90 100
YDVTRNPHLN KGMAFTLEER LQLGIHGLIP PCFLSQDVQL LRIMRYYERQ
110 120 130 140 150
QSDLDKYIIL MTLQDRNEKL FYRVLTSDVE KFMPIVYTPT VGLACQHYGL
160 170 180 190 200
TFRRPRGLFI TIHDKGHLAT MLNSWPEDNI KAVVVTDGER ILGLGDLGCY
210 220 230 240 250
GMGIPVGKLA LYTACGGVNP QQCLPVLLDV GTNNEELLRD PLYIGLKHQR
260 270 280 290 300
VHGKAYDDLL DEFMQAVTDK FGINCLIQFE DFANANAFRL LNKYRNKYCM
310 320 330 340 350
FNDDIQGTAS VAVAGILAAL RITKNKLSNH VFVFQGAGEA AMGIAHLLVM
360 370 380 390 400
ALEKEGVPKA EATRKIWMVD SKGLIVKGRS HLNHEKEMFA QDHPEVNSLE
410 420 430 440 450
EVVRLVKPTA IIGVAAIAGA FTEQILRDMA SFHERPIIFA LSNPTSKAEC
460 470 480 490 500
TAEKCYRVTE GRGIFASGSP FKSVTLEDGK TFIPGQGNNA YVFPGVALGV
510 520 530 540 550
IAGGIRHIPD EIFLLTAEQI AQEVSEQHLS QGRLYPPLST IRDVSLRIAI
560 570 580 590 600
KVLDYAYKHN LASYYPEPKD KEAFVRSLVY TPDYDSFTLD SYTWPKEAMN

VQTV
Length:604
Mass (Da):67,068
Last modified:November 25, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE0E79A75F3CAC524
GO
Isoform 2 (identifier: Q16798-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     309-342: ASVAVAGILAALRITKNKLSNHVFVFQGAGEAAM → TCHTFSCPWHLWAQVMFQHIPGPMGFSEWLPRNS
     343-604: Missing.

Show »
Length:342
Mass (Da):38,626
Checksum:iBC18F52DF85F2BB8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PMB9E9PMB9_HUMAN
Malic enzyme
ME3
580Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q6TCH8Q6TCH8_HUMAN
Mitochondrial NADP(+)-dependent mal...
ME3
259Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PNN2E9PNN2_HUMAN
NADP-dependent malic enzyme, mitoch...
ME3
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PKA0E9PKA0_HUMAN
NADP-dependent malic enzyme, mitoch...
ME3
79Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PND9E9PND9_HUMAN
NADP-dependent malic enzyme, mitoch...
ME3
61Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti95R → G in AAH22472 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04736985S → G1 PublicationCorresponds to variant dbSNP:rs17856661Ensembl.1
Natural variantiVAR_047370324K → N2 PublicationsCorresponds to variant dbSNP:rs1042780Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_056626309 – 342ASVAV…GEAAM → TCHTFSCPWHLWAQVMFQHI PGPMGFSEWLPRNS in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_056627343 – 604Missing in isoform 2. 1 PublicationAdd BLAST262

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X79440 mRNA Translation: CAA55956.1
AK300974 mRNA Translation: BAH13386.1
AP001148 Genomic DNA No translation available.
AP001831 Genomic DNA No translation available.
AP002492 Genomic DNA No translation available.
BC022472 mRNA Translation: AAH22472.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS8277.1 [Q16798-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
S53351

NCBI Reference Sequences

More...
RefSeqi
NP_001014811.1, NM_001014811.1 [Q16798-1]
NP_001155058.1, NM_001161586.1 [Q16798-1]
NP_006671.2, NM_006680.2 [Q16798-1]
XP_005273774.1, XM_005273717.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000393324; ENSP00000376998; ENSG00000151376 [Q16798-1]
ENST00000526504; ENSP00000433636; ENSG00000151376 [Q16798-2]
ENST00000543262; ENSP00000440246; ENSG00000151376 [Q16798-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
10873

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:10873

UCSC genome browser

More...
UCSCi
uc001pbz.3 human [Q16798-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X79440 mRNA Translation: CAA55956.1
AK300974 mRNA Translation: BAH13386.1
AP001148 Genomic DNA No translation available.
AP001831 Genomic DNA No translation available.
AP002492 Genomic DNA No translation available.
BC022472 mRNA Translation: AAH22472.1
CCDSiCCDS8277.1 [Q16798-1]
PIRiS53351
RefSeqiNP_001014811.1, NM_001014811.1 [Q16798-1]
NP_001155058.1, NM_001161586.1 [Q16798-1]
NP_006671.2, NM_006680.2 [Q16798-1]
XP_005273774.1, XM_005273717.1

3D structure databases

SMRiQ16798
ModBaseiSearch...

Protein-protein interaction databases

BioGridi116081, 1 interactor
STRINGi9606.ENSP00000440246

Chemistry databases

ChEMBLiCHEMBL6182
DrugBankiDB00157 NADH
DB03680 Tartronate

PTM databases

iPTMnetiQ16798
PhosphoSitePlusiQ16798

Polymorphism and mutation databases

BioMutaiME3
DMDMi215274021

Proteomic databases

EPDiQ16798
jPOSTiQ16798
MassIVEiQ16798
MaxQBiQ16798
PaxDbiQ16798
PeptideAtlasiQ16798
PRIDEiQ16798
ProteomicsDBi61073 [Q16798-1]
6809

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
10873

Genome annotation databases

EnsembliENST00000393324; ENSP00000376998; ENSG00000151376 [Q16798-1]
ENST00000526504; ENSP00000433636; ENSG00000151376 [Q16798-2]
ENST00000543262; ENSP00000440246; ENSG00000151376 [Q16798-1]
GeneIDi10873
KEGGihsa:10873
UCSCiuc001pbz.3 human [Q16798-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10873
EuPathDBiHostDB:ENSG00000151376.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ME3
HGNCiHGNC:6985 ME3
HPAiHPA038473
MIMi604626 gene
neXtProtiNX_Q16798
OpenTargetsiENSG00000151376
PharmGKBiPA30725

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1257 Eukaryota
COG0281 LUCA
GeneTreeiENSGT00950000183134
HOGENOMiHOG000042486
InParanoidiQ16798
KOiK00029
OMAiWIREQMW
OrthoDBi435571at2759
PhylomeDBiQ16798
TreeFamiTF300537

Enzyme and pathway databases

ReactomeiR-HSA-71403 Citric acid cycle (TCA cycle)
SABIO-RKiQ16798

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ME3 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
10873
PharosiQ16798 Tbio

Protein Ontology

More...
PROi
PR:Q16798
RNActiQ16798 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000151376 Expressed in 211 organ(s), highest expression level in caudate nucleus
ExpressionAtlasiQ16798 baseline and differential
GenevisibleiQ16798 HS

Family and domain databases

Gene3Di3.40.50.10380, 1 hit
InterProiView protein in InterPro
IPR015884 Malic_enzyme_CS
IPR012301 Malic_N_dom
IPR037062 Malic_N_dom_sf
IPR012302 Malic_NAD-bd
IPR001891 Malic_OxRdtase
IPR036291 NAD(P)-bd_dom_sf
PfamiView protein in Pfam
PF00390 malic, 1 hit
PF03949 Malic_M, 1 hit
PIRSFiPIRSF000106 ME, 1 hit
PRINTSiPR00072 MALOXRDTASE
SMARTiView protein in SMART
SM01274 malic, 1 hit
SM00919 Malic_M, 1 hit
SUPFAMiSSF51735 SSF51735, 1 hit
PROSITEiView protein in PROSITE
PS00331 MALIC_ENZYMES, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMAON_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q16798
Secondary accession number(s): B7Z6V0, Q8TBJ0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 25, 2008
Last modified: December 11, 2019
This is version 171 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again