Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NADP-dependent malic enzyme, mitochondrial

Gene

ME3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Catalytic activityi

(S)-malate + NADP+ = pyruvate + CO2 + NADPH.
Oxaloacetate = pyruvate + CO2.

Cofactori

Mg2+By similarity, Mn2+By similarityNote: Divalent metal cations. Prefers magnesium or manganese.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei137Proton donorBy similarity1
Binding sitei190NADBy similarity1
Active sitei208Proton acceptorBy similarity1
Metal bindingi280Divalent metal cationBy similarity1
Metal bindingi281Divalent metal cationBy similarity1
Metal bindingi304Divalent metal cationBy similarity1
Binding sitei304NADBy similarity1
Sitei304Important for activityBy similarity1
Binding sitei443NADBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionOxidoreductase
LigandMetal-binding, NADP

Enzyme and pathway databases

ReactomeiR-HSA-71403 Citric acid cycle (TCA cycle)
SABIO-RKiQ16798

Names & Taxonomyi

Protein namesi
Recommended name:
NADP-dependent malic enzyme, mitochondrial (EC:1.1.1.40)
Short name:
NADP-ME
Alternative name(s):
Malic enzyme 3
Gene namesi
Name:ME3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000151376.16
HGNCiHGNC:6985 ME3
MIMi604626 gene
neXtProtiNX_Q16798

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

DisGeNETi10873
OpenTargetsiENSG00000151376
PharmGKBiPA30725

Chemistry databases

ChEMBLiCHEMBL6182
DrugBankiDB00157 NADH
DB03680 Tartronate

Polymorphism and mutation databases

BioMutaiME3
DMDMi215274021

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_0000018539? – 604NADP-dependent malic enzyme, mitochondrial
Transit peptidei1 – ?MitochondrionSequence analysis

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei371PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ16798
MaxQBiQ16798
PaxDbiQ16798
PeptideAtlasiQ16798
PRIDEiQ16798
ProteomicsDBi61073

PTM databases

iPTMnetiQ16798
PhosphoSitePlusiQ16798

Expressioni

Tissue specificityi

Expressed predominantly in organs with a low-division rate.

Gene expression databases

BgeeiENSG00000151376 Expressed in 211 organ(s), highest expression level in caudate nucleus
CleanExiHS_ME3
ExpressionAtlasiQ16798 baseline and differential
GenevisibleiQ16798 HS

Organism-specific databases

HPAiHPA038473

Interactioni

Protein-protein interaction databases

BioGridi116081, 1 interactor
STRINGi9606.ENSP00000352657

Structurei

3D structure databases

ProteinModelPortaliQ16798
SMRiQ16798
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the malic enzymes family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG1257 Eukaryota
COG0281 LUCA
GeneTreeiENSGT00390000000754
HOGENOMiHOG000042486
HOVERGENiHBG000746
InParanoidiQ16798
KOiK00029
OMAiGVNGMPI
OrthoDBiEOG091G04H9
PhylomeDBiQ16798
TreeFamiTF300537

Family and domain databases

Gene3Di3.40.50.10380, 1 hit
InterProiView protein in InterPro
IPR015884 Malic_enzyme_CS
IPR012301 Malic_N_dom
IPR037062 Malic_N_dom_sf
IPR012302 Malic_NAD-bd
IPR001891 Malic_OxRdtase
IPR036291 NAD(P)-bd_dom_sf
PfamiView protein in Pfam
PF00390 malic, 1 hit
PF03949 Malic_M, 1 hit
PIRSFiPIRSF000106 ME, 1 hit
PRINTSiPR00072 MALOXRDTASE
SMARTiView protein in SMART
SM01274 malic, 1 hit
SM00919 Malic_M, 1 hit
SUPFAMiSSF51735 SSF51735, 1 hit
PROSITEiView protein in PROSITE
PS00331 MALIC_ENZYMES, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q16798-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGAALGTGTR LAPWPGRACG ALPRWTPTAP AQGCHSKPGP ARPVPLKKRG
60 70 80 90 100
YDVTRNPHLN KGMAFTLEER LQLGIHGLIP PCFLSQDVQL LRIMRYYERQ
110 120 130 140 150
QSDLDKYIIL MTLQDRNEKL FYRVLTSDVE KFMPIVYTPT VGLACQHYGL
160 170 180 190 200
TFRRPRGLFI TIHDKGHLAT MLNSWPEDNI KAVVVTDGER ILGLGDLGCY
210 220 230 240 250
GMGIPVGKLA LYTACGGVNP QQCLPVLLDV GTNNEELLRD PLYIGLKHQR
260 270 280 290 300
VHGKAYDDLL DEFMQAVTDK FGINCLIQFE DFANANAFRL LNKYRNKYCM
310 320 330 340 350
FNDDIQGTAS VAVAGILAAL RITKNKLSNH VFVFQGAGEA AMGIAHLLVM
360 370 380 390 400
ALEKEGVPKA EATRKIWMVD SKGLIVKGRS HLNHEKEMFA QDHPEVNSLE
410 420 430 440 450
EVVRLVKPTA IIGVAAIAGA FTEQILRDMA SFHERPIIFA LSNPTSKAEC
460 470 480 490 500
TAEKCYRVTE GRGIFASGSP FKSVTLEDGK TFIPGQGNNA YVFPGVALGV
510 520 530 540 550
IAGGIRHIPD EIFLLTAEQI AQEVSEQHLS QGRLYPPLST IRDVSLRIAI
560 570 580 590 600
KVLDYAYKHN LASYYPEPKD KEAFVRSLVY TPDYDSFTLD SYTWPKEAMN

VQTV
Length:604
Mass (Da):67,068
Last modified:November 25, 2008 - v2
Checksum:iE0E79A75F3CAC524
GO
Isoform 2 (identifier: Q16798-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     309-342: ASVAVAGILAALRITKNKLSNHVFVFQGAGEAAM → TCHTFSCPWHLWAQVMFQHIPGPMGFSEWLPRNS
     343-604: Missing.

Note: No experimental confirmation available.
Show »
Length:342
Mass (Da):38,626
Checksum:iBC18F52DF85F2BB8
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PMB9E9PMB9_HUMAN
Malic enzyme
ME3
580Annotation score:
Q6TCH8Q6TCH8_HUMAN
Mitochondrial NADP(+)-dependent mal...
ME3
259Annotation score:
E9PNN2E9PNN2_HUMAN
NADP-dependent malic enzyme, mitoch...
ME3
151Annotation score:
E9PKA0E9PKA0_HUMAN
NADP-dependent malic enzyme, mitoch...
ME3
79Annotation score:
E9PND9E9PND9_HUMAN
NADP-dependent malic enzyme, mitoch...
ME3
61Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti95R → G in AAH22472 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04736985S → G1 PublicationCorresponds to variant dbSNP:rs17856661Ensembl.1
Natural variantiVAR_047370324K → N2 PublicationsCorresponds to variant dbSNP:rs1042780Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_056626309 – 342ASVAV…GEAAM → TCHTFSCPWHLWAQVMFQHI PGPMGFSEWLPRNS in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_056627343 – 604Missing in isoform 2. 1 PublicationAdd BLAST262

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X79440 mRNA Translation: CAA55956.1
AK300974 mRNA Translation: BAH13386.1
AP001148 Genomic DNA No translation available.
AP001831 Genomic DNA No translation available.
AP002492 Genomic DNA No translation available.
BC022472 mRNA Translation: AAH22472.1
CCDSiCCDS8277.1 [Q16798-1]
PIRiS53351
RefSeqiNP_001014811.1, NM_001014811.1 [Q16798-1]
NP_001155058.1, NM_001161586.1 [Q16798-1]
NP_006671.2, NM_006680.2 [Q16798-1]
XP_005273774.1, XM_005273717.1
UniGeneiHs.199743

Genome annotation databases

EnsembliENST00000393324; ENSP00000376998; ENSG00000151376 [Q16798-1]
ENST00000526504; ENSP00000433636; ENSG00000151376 [Q16798-2]
ENST00000543262; ENSP00000440246; ENSG00000151376 [Q16798-1]
GeneIDi10873
KEGGihsa:10873
UCSCiuc001pbz.3 human [Q16798-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X79440 mRNA Translation: CAA55956.1
AK300974 mRNA Translation: BAH13386.1
AP001148 Genomic DNA No translation available.
AP001831 Genomic DNA No translation available.
AP002492 Genomic DNA No translation available.
BC022472 mRNA Translation: AAH22472.1
CCDSiCCDS8277.1 [Q16798-1]
PIRiS53351
RefSeqiNP_001014811.1, NM_001014811.1 [Q16798-1]
NP_001155058.1, NM_001161586.1 [Q16798-1]
NP_006671.2, NM_006680.2 [Q16798-1]
XP_005273774.1, XM_005273717.1
UniGeneiHs.199743

3D structure databases

ProteinModelPortaliQ16798
SMRiQ16798
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116081, 1 interactor
STRINGi9606.ENSP00000352657

Chemistry databases

ChEMBLiCHEMBL6182
DrugBankiDB00157 NADH
DB03680 Tartronate

PTM databases

iPTMnetiQ16798
PhosphoSitePlusiQ16798

Polymorphism and mutation databases

BioMutaiME3
DMDMi215274021

Proteomic databases

EPDiQ16798
MaxQBiQ16798
PaxDbiQ16798
PeptideAtlasiQ16798
PRIDEiQ16798
ProteomicsDBi61073

Protocols and materials databases

DNASUi10873
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000393324; ENSP00000376998; ENSG00000151376 [Q16798-1]
ENST00000526504; ENSP00000433636; ENSG00000151376 [Q16798-2]
ENST00000543262; ENSP00000440246; ENSG00000151376 [Q16798-1]
GeneIDi10873
KEGGihsa:10873
UCSCiuc001pbz.3 human [Q16798-1]

Organism-specific databases

CTDi10873
DisGeNETi10873
EuPathDBiHostDB:ENSG00000151376.16
GeneCardsiME3
H-InvDBiHIX0010004
HGNCiHGNC:6985 ME3
HPAiHPA038473
MIMi604626 gene
neXtProtiNX_Q16798
OpenTargetsiENSG00000151376
PharmGKBiPA30725
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1257 Eukaryota
COG0281 LUCA
GeneTreeiENSGT00390000000754
HOGENOMiHOG000042486
HOVERGENiHBG000746
InParanoidiQ16798
KOiK00029
OMAiGVNGMPI
OrthoDBiEOG091G04H9
PhylomeDBiQ16798
TreeFamiTF300537

Enzyme and pathway databases

ReactomeiR-HSA-71403 Citric acid cycle (TCA cycle)
SABIO-RKiQ16798

Miscellaneous databases

ChiTaRSiME3 human
GenomeRNAii10873
PROiPR:Q16798
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000151376 Expressed in 211 organ(s), highest expression level in caudate nucleus
CleanExiHS_ME3
ExpressionAtlasiQ16798 baseline and differential
GenevisibleiQ16798 HS

Family and domain databases

Gene3Di3.40.50.10380, 1 hit
InterProiView protein in InterPro
IPR015884 Malic_enzyme_CS
IPR012301 Malic_N_dom
IPR037062 Malic_N_dom_sf
IPR012302 Malic_NAD-bd
IPR001891 Malic_OxRdtase
IPR036291 NAD(P)-bd_dom_sf
PfamiView protein in Pfam
PF00390 malic, 1 hit
PF03949 Malic_M, 1 hit
PIRSFiPIRSF000106 ME, 1 hit
PRINTSiPR00072 MALOXRDTASE
SMARTiView protein in SMART
SM01274 malic, 1 hit
SM00919 Malic_M, 1 hit
SUPFAMiSSF51735 SSF51735, 1 hit
PROSITEiView protein in PROSITE
PS00331 MALIC_ENZYMES, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMAON_HUMAN
AccessioniPrimary (citable) accession number: Q16798
Secondary accession number(s): B7Z6V0, Q8TBJ0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 25, 2008
Last modified: November 7, 2018
This is version 162 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again