UniProtKB - Q16655 (MAR1_HUMAN)

BLAST

>sp|Q16655|MAR1_HUMAN Melanoma antigen recognized by T-cells 1 OS=Homo sapiens OX=9606 GN=MLANA PE=1 SV=1
MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDK
SLHVGTQCALTRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP

Align
Format
Add to basket Added to basket
History
Entry version 135 (07 Nov 2018)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Melanoma antigen recognized by T-cells 1

Gene

MLANA

Organism

Homo sapiens (Human)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Involved in melanosome biogenesis by ensuring the stability of GPR143. Plays a vital role in the expression, stability, trafficking, and processing of melanocyte protein PMEL, which is critical to the formation of stage II melanosomes.2 Publications

Enzyme and pathway databases

SIGNORⁱ	Q16655

SIGNORⁱ

Q16655

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Melanoma antigen recognized by T-cells 1 Short name: MART-1 Alternative name(s): Antigen LB39-AA Antigen SK29-AA Protein Melan-A
Gene namesⁱ	Name:MLANA Synonyms:MART1
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 9

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000120215.9
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:7124 MLANA
MIMⁱ	605513 gene
neXtProtⁱ	NX_Q16655

Topology

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Transmembraneⁱ	27 – 47	HelicalSequence analysisAdd BLAST		21
Topological domainⁱ	48 – 118	CytoplasmicSequence analysisAdd BLAST		71

Keywords - Cellular componentⁱ

Endoplasmic reticulum, Golgi apparatus, Membrane

Pathology & Biotechⁱ

Organism-specific databases

DisGeNET More...DisGeNETⁱ	2315
Open Targets More...OpenTargetsⁱ	ENSG00000120215
PharmGKBⁱ	PA30842

Polymorphism and mutation databases

BioMutaⁱ	MLANA
DMDMⁱ	2833278

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000096238	1 – 118	Melanoma antigen recognized by T-cells 1Add BLAST		118

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Modified residueⁱ	108	Phosphoserine1 Publication		1

Post-translational modificationⁱ

Acylated.1 Publication

Keywords - PTMⁱ

Phosphoprotein

Proteomic databases

EPDⁱ	Q16655
PaxDbⁱ	Q16655
PeptideAtlas More...PeptideAtlasⁱ	Q16655
PRIDEⁱ	Q16655
ProteomicsDBⁱ	61014

PTM databases

iPTMnetⁱ	Q16655
PhosphoSitePlusⁱ	Q16655
SwissPalmⁱ	Q16655

Expressionⁱ

Tissue specificityⁱ

Expression is restricted to melanoma and melanocyte cell lines and retina.

Gene expression databases

Bgeeⁱ	ENSG00000120215 Expressed in 98 organ(s), highest expression level in material anatomical entity
CleanExⁱ	HS_MLANA
Genevisibleⁱ	Q16655 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	CAB000057 HPA048662

HPAⁱ

CAB000057
HPA048662

Interactionⁱ

Subunit structureⁱ

Interacts with PMEL. Interacts with GPR143.3 Publications

Protein-protein interaction databases

BioGridⁱ	108604, 2 interactors
IntActⁱ	Q16655, 4 interactors
Molecular INTeraction database More...MINTⁱ	Q16655
STRINGⁱ	9606.ENSP00000370880

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Beta strandⁱ	29 – 31	Combined sources		3

Show more details

3D structure databases

ProteinModelPortalⁱ	Q16655
SMRⁱ	Q16655
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	Q16655

EvolutionaryTraceⁱ

Q16655

Family & Domainsⁱ

Keywords - Domainⁱ

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	ENOG410IZ4C Eukaryota ENOG410ZDIV LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000009531
HOGENOMⁱ	HOG000113481
HOVERGENⁱ	HBG006327
InParanoidⁱ	Q16655
KEGG Orthology (KO) More...KOⁱ	K17303
OMAⁱ	FQENNCE
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0Z8N
PhylomeDBⁱ	Q16655
TreeFamⁱ	TF338577

Family and domain databases

InterProⁱ	View protein in InterPro IPR029242 MLANA
PANTHERⁱ	PTHR15305 PTHR15305, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF14991 MLANA, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Q16655-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MPREDAHFIY GYPKKGHGHS YTTAEEAAGI GILTVILGVL LLIGCWYCRR 
        60         70         80         90        100
RNGYRALMDK SLHVGTQCAL TRRCPQEGFD HRDSKVSLQE KNCEPVVPNA 
       110 
PPAYEKLSAE QSPPPYSP

Length:118

Mass (Da):13,157

Last modified:November 1, 1996 - v1

Checksum:ⁱB755BFF39CFCB16E

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U06452 mRNA Translation: AAA19238.1 U06654 mRNA Translation: AAA20389.1 CR450299 mRNA Translation: CAG29295.1 AK312149 mRNA Translation: BAG35083.1 AL365360 Genomic DNA No translation available. CH471071 Genomic DNA Translation: EAW58755.1 CH471071 Genomic DNA Translation: EAW58756.1 BC014423 mRNA Translation: AAH14423.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS6466.1
PIRⁱ	A55253
NCBI Reference Sequences More...RefSeqⁱ	NP_005502.1, NM_005511.1
UniGeneⁱ	Hs.154069

Genome annotation databases

Ensemblⁱ	ENST00000381471; ENSP00000370880; ENSG00000120215 ENST00000381476; ENSP00000370885; ENSG00000120215 ENST00000381477; ENSP00000370886; ENSG00000120215
GeneIDⁱ	2315
KEGGⁱ	hsa:2315
UCSC genome browser More...UCSCⁱ	uc003zjo.2 human

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
Q16655	MLANA isoform 1		PANTR		118	UniRef100_Q16655
Uncharacterized protein		PANPA		118
Melan-A		GORGO		118

Protein	Similar proteins		Species	Score	Length	Source
Q16655	MLANA isoform 1		PANTR		118	UniRef90_Q16655
Uncharacterized protein		PANPA		118
Melan-A		GORGO		118
Melan-A		MACFA		118
Melanoma antigen recognized by T-cells 1		MACMU		118
+10

Protein	Similar proteins		Species	Score	Length	Source
Q16655	MLANA isoform 1		PANTR		118	UniRef50_Q16655
Uncharacterized protein		PANPA		118
Melan-A		GORGO		118
Uncharacterized protein		NOMLE		118
Melan-A		MACFA		118
+89

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U06452 mRNA Translation: AAA19238.1 U06654 mRNA Translation: AAA20389.1 CR450299 mRNA Translation: CAG29295.1 AK312149 mRNA Translation: BAG35083.1 AL365360 Genomic DNA No translation available. CH471071 Genomic DNA Translation: EAW58755.1 CH471071 Genomic DNA Translation: EAW58756.1 BC014423 mRNA Translation: AAH14423.1
CCDSⁱ	CCDS6466.1
PIRⁱ	A55253
RefSeqⁱ	NP_005502.1, NM_005511.1
UniGeneⁱ	Hs.154069

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	2GT9	X-ray	1.75	C/F	26-35	[»]
	2GTW	X-ray	1.55	C/F	27-35	[»]
	2GTZ	X-ray	1.70	C/F	27-35	[»]
	2GUO	X-ray	1.90	C/F	27-35	[»]
	3HG1	X-ray	3.00	C	26-35	[»]
	3L6F	X-ray	2.10	C	100-114	[»]
	3MRO	X-ray	2.35	P	26-35	[»]
	3MRP	X-ray	2.10	P	26-35	[»]
	3MRQ	X-ray	2.20	P	26-35	[»]
	3QDM	X-ray	2.80	C	26-35	[»]
	3QEQ	X-ray	2.59	C	27-35	[»]
	3QFD	X-ray	1.68	C/F	27-35	[»]
	4EUP	X-ray	2.88	C/F	27-35	[»]
	4JFF	X-ray	2.43	C	26-35	[»]
	4L3E	X-ray	2.56	C	26-35	[»]
	4QOK	X-ray	3.00	C	26-35	[»]
	4WJ5	X-ray	1.65	C/F	28-34	[»]
	5E9D	X-ray	2.51	C/H	26-35	[»]
	5NHT	X-ray	3.20	P	26-35	[»]
	5NQK	X-ray	3.25	P	26-35	[»]
ProteinModelPortalⁱ	Q16655
SMRⁱ	Q16655
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	108604, 2 interactors
IntActⁱ	Q16655, 4 interactors
MINTⁱ	Q16655
STRINGⁱ	9606.ENSP00000370880

PTM databases

iPTMnetⁱ	Q16655
PhosphoSitePlusⁱ	Q16655
SwissPalmⁱ	Q16655

Polymorphism and mutation databases

BioMutaⁱ	MLANA
DMDMⁱ	2833278

Proteomic databases

EPDⁱ	Q16655
PaxDbⁱ	Q16655
PeptideAtlasⁱ	Q16655
PRIDEⁱ	Q16655
ProteomicsDBⁱ	61014

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	2315
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000381471; ENSP00000370880; ENSG00000120215 ENST00000381476; ENSP00000370885; ENSG00000120215 ENST00000381477; ENSP00000370886; ENSG00000120215
GeneIDⁱ	2315
KEGGⁱ	hsa:2315
UCSCⁱ	uc003zjo.2 human

Organism-specific databases

CTDⁱ	2315
DisGeNETⁱ	2315
EuPathDBⁱ	HostDB:ENSG00000120215.9
GeneCardsⁱ	MLANA
HGNCⁱ	HGNC:7124 MLANA
HPAⁱ	CAB000057 HPA048662
MIMⁱ	605513 gene
neXtProtⁱ	NX_Q16655
OpenTargetsⁱ	ENSG00000120215
PharmGKBⁱ	PA30842
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410IZ4C Eukaryota ENOG410ZDIV LUCA
GeneTreeⁱ	ENSGT00390000009531
HOGENOMⁱ	HOG000113481
HOVERGENⁱ	HBG006327
InParanoidⁱ	Q16655
KOⁱ	K17303
OMAⁱ	FQENNCE
OrthoDBⁱ	EOG091G0Z8N
PhylomeDBⁱ	Q16655
TreeFamⁱ	TF338577

Enzyme and pathway databases

SIGNORⁱ	Q16655

SIGNORⁱ

Q16655

Miscellaneous databases

ChiTaRSⁱ	MLANA human
EvolutionaryTraceⁱ	Q16655
GeneWikiⁱ	MLANA
GenomeRNAiⁱ	2315
Protein Ontology More...PROⁱ	PR:Q16655
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000120215 Expressed in 98 organ(s), highest expression level in material anatomical entity
CleanExⁱ	HS_MLANA
Genevisibleⁱ	Q16655 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR029242 MLANA
PANTHERⁱ	PTHR15305 PTHR15305, 1 hit
Pfamⁱ	View protein in Pfam PF14991 MLANA, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	MAR1_HUMAN
Accessionⁱ	Q16655Primary (citable) accession number: Q16655 Secondary accession number(s): Q6ICU4
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	November 1, 1997
	Last sequence update:	November 1, 1996
	Last modified:	November 7, 2018
	This is version 135 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Human chromosome 9
Human chromosome 9: entries, gene names and cross-references to MIM

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - Q16655 (MAR1_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Melanoma antigen recognized by T-cells 1

MLANA

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Golgi apparatus

Endoplasmic reticulum

Other locations

Endoplasmic reticulum

Golgi apparatus

Plasma Membrane

Other locations

Topology

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Keywords - Domainⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ