Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myelin-oligodendrocyte glycoprotein

Gene

MOG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Mediates homophilic cell-cell adhesion (By similarity). Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication.By similarity
(Microbial infection) Acts as a receptor for rubella virus.1 Publication

Caution

Do not confuse myelin-oligodendrocyte glycoprotein (MOG) with oligodendrocyte-myelin glycoprotein (OMG).Curated

GO - Molecular functioni

GO - Biological processi

  • cell adhesion Source: UniProtKB-KW
  • central nervous system development Source: ProtInc

Keywordsi

Molecular functionHost cell receptor for virus entry, Receptor
Biological processCell adhesion, Host-virus interaction

Names & Taxonomyi

Protein namesi
Recommended name:
Myelin-oligodendrocyte glycoprotein
Gene namesi
Name:MOG
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000204655.11
HGNCiHGNC:7197 MOG
MIMi159465 gene
neXtProtiNX_Q16653

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini30 – 154ExtracellularSequence analysisAdd BLAST125
Transmembranei155 – 175HelicalSequence analysisAdd BLAST21
Topological domaini176 – 210CytoplasmicSequence analysisAdd BLAST35
Transmembranei211 – 231HelicalSequence analysisAdd BLAST21
Topological domaini232 – 247ExtracellularSequence analysisAdd BLAST16

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Narcolepsy 7 (NRCLP7)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionNeurological disabling sleep disorder, characterized by excessive daytime sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-movement (REM) sleep, cataplexy, hypnagogic hallucinations, and sleep paralysis. Cataplexy is a sudden loss of muscle tone triggered by emotions, which is the most valuable clinical feature used to diagnose narcolepsy. Human narcolepsy is primarily a sporadically occurring disorder but familial clustering has been observed.
See also OMIM:614250
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_066415133S → C in NRCLP7. 1 PublicationCorresponds to variant dbSNP:rs387906655EnsemblClinVar.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi4340
MalaCardsiMOG
MIMi614250 phenotype
OpenTargetsiENSG00000204655
Orphaneti2073 Narcolepsy-cataplexy
PharmGKBiPA30905

Polymorphism and mutation databases

BioMutaiMOG
DMDMi317373391

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 29Sequence analysisAdd BLAST29
ChainiPRO_000001488830 – 247Myelin-oligodendrocyte glycoproteinAdd BLAST218

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi53 ↔ 127PROSITE-ProRule annotation
Glycosylationi60N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ16653
PeptideAtlasiQ16653
PRIDEiQ16653
ProteomicsDBi61003
61004 [Q16653-10]
61005 [Q16653-2]
61006 [Q16653-3]
61007 [Q16653-4]
61008 [Q16653-5]
61009 [Q16653-6]
61010 [Q16653-7]
61011 [Q16653-8]
61012 [Q16653-9]

PTM databases

iPTMnetiQ16653
PhosphoSitePlusiQ16653
SwissPalmiQ16653

Expressioni

Tissue specificityi

Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes.

Gene expression databases

BgeeiENSG00000204655
ExpressionAtlasiQ16653 baseline and differential
GenevisibleiQ16653 HS

Organism-specific databases

HPAiHPA021873

Interactioni

Subunit structurei

Homodimer (By similarity). May form heterodimers between the different isoforms (By similarity).By similarity
(Microbial infection) Interacts with rubella virus E2 glycoprotein.1 Publication

Protein-protein interaction databases

BioGridi110482, 1 interactor
IntActiQ16653, 1 interactor
STRINGi9606.ENSP00000366095

Structurei

3D structure databases

ProteinModelPortaliQ16653
SMRiQ16653
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini32 – 145Ig-like V-typeAdd BLAST114

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IKKW Eukaryota
ENOG41119UE LUCA
GeneTreeiENSGT00910000144095
HOGENOMiHOG000213934
HOVERGENiHBG004565
InParanoidiQ16653
KOiK17270
OrthoDBiEOG091G0JF2
PhylomeDBiQ16653
TreeFamiTF331083

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
IPR016663 Myelin-oligodendrocyte_glycop
PfamiView protein in Pfam
PF07686 V-set, 1 hit
PIRSFiPIRSF016522 MOG, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SM00406 IGv, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit

Sequences (13)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 13 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q16653-1) [UniParc]FASTAAdd to basket
Also known as: Alpha-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASLSRPSLP SCLCSFLLLL LLQVSSSYAG QFRVIGPRHP IRALVGDEVE
60 70 80 90 100
LPCRISPGKN ATGMEVGWYR PPFSRVVHLY RNGKDQDGDQ APEYRGRTEL
110 120 130 140 150
LKDAIGEGKV TLRIRNVRFS DEGGFTCFFR DHSYQEEAAM ELKVEDPFYW
160 170 180 190 200
VSPGVLVLLA VLPVLLLQIT VGLIFLCLQY RLRGKLRAEI ENLHRTFDPH
210 220 230 240
FLRVPCWKIT LFVIVPVLGP LVALIICYNW LHRRLAGQFL EELRNPF
Length:247
Mass (Da):28,193
Last modified:January 11, 2011 - v2
Checksum:i846EBA5D412C080C
GO
Isoform 2 (identifier: Q16653-2) [UniParc]FASTAAdd to basket
Also known as: Alpha-2

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: Missing.

Show »
Length:208
Mass (Da):23,627
Checksum:i8053FA07957A1963
GO
Isoform 3 (identifier: Q16653-3) [UniParc]FASTAAdd to basket
Also known as: Alpha-3

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT

Show »
Length:224
Mass (Da):25,353
Checksum:iEF7BA1567A69FB33
GO
Isoform 4 (identifier: Q16653-4) [UniParc]FASTAAdd to basket
Also known as: Alpha-4

The sequence of this isoform differs from the canonical sequence as follows:
     30-145: Missing.

Show »
Length:131
Mass (Da):14,988
Checksum:i80B843738BF1ED47
GO
Isoform 5 (identifier: Q16653-5) [UniParc]FASTAAdd to basket
Also known as: Beta-1

The sequence of this isoform differs from the canonical sequence as follows:
     244-247: RNPF → LFHLEALSG

Show »
Length:252
Mass (Da):28,647
Checksum:iD41E3A6050BA9837
GO
Isoform 6 (identifier: Q16653-6) [UniParc]FASTAAdd to basket
Also known as: Beta-2

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: Missing.
     244-247: RNPF → LFHLEALSG

Show »
Length:213
Mass (Da):24,081
Checksum:iAD5788DAB32EA577
GO
Isoform 7 (identifier: Q16653-7) [UniParc]FASTAAdd to basket
Also known as: Beta-3

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT
     244-247: RNPF → LFHLEALSG

Show »
Length:229
Mass (Da):25,807
Checksum:iDB6C018BA4418D2C
GO
Isoform 8 (identifier: Q16653-8) [UniParc]FASTAAdd to basket
Also known as: Beta-4

The sequence of this isoform differs from the canonical sequence as follows:
     198-243: Missing.
     244-247: RNPF → LFHLEALSG

Show »
Length:206
Mass (Da):23,264
Checksum:i54D1257CD963AD8E
GO
Isoform 9 (identifier: Q16653-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     198-203: DPHFLR → GKFRHV
     204-247: Missing.

Note: Not functionally active. May be expressed at low level in the adult.
Show »
Length:203
Mass (Da):23,021
Checksum:i33C38085A4D22627
GO
Isoform 10 (identifier: Q16653-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     146-171: DPFYWVSPGVLVLLAVLPVLLLQITV → VSHSVTQDWLQWHDHGSLQPPPPRLK
     172-247: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:171
Mass (Da):19,334
Checksum:iE65BA3858848F8E8
GO
Isoform 11 (identifier: Q16653-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     198-247: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF → VFHLEALSG

Show »
Length:206
Mass (Da):23,250
Checksum:i4823257CD963AD8E
GO
Isoform 12 (identifier: Q16653-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     30-145: Missing.
     198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT

Show »
Length:108
Mass (Da):12,149
Checksum:iEB06EC1E6C59C842
GO
Isoform 13 (identifier: Q16653-13) [UniParc]FASTAAdd to basket
Also known as: X1

The sequence of this isoform differs from the canonical sequence as follows:
     245-247: NPF → KFSSLCYKQRIKSQERETEATRGRGGLLRDHIPRGKEELESLGGGKTPPGR

Note: No experimental confirmation available.
Show »
Length:295
Mass (Da):33,528
Checksum:i2310179859868716
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_066415133S → C in NRCLP7. 1 PublicationCorresponds to variant dbSNP:rs387906655EnsemblClinVar.1
Natural variantiVAR_056056171V → L2 PublicationsCorresponds to variant dbSNP:rs2857766Ensembl.1
Natural variantiVAR_060215174I → V10 PublicationsCorresponds to variant dbSNP:rs3130253Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00253930 – 145Missing in isoform 4 and isoform 12. 1 PublicationAdd BLAST116
Alternative sequenceiVSP_040344146 – 171DPFYW…LQITV → VSHSVTQDWLQWHDHGSLQP PPPRLK in isoform 10. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_040345172 – 247Missing in isoform 10. 1 PublicationAdd BLAST76
Alternative sequenceiVSP_046856198 – 247DPHFL…LRNPF → VFHLEALSG in isoform 11. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_002544198 – 243Missing in isoform 8. CuratedAdd BLAST46
Alternative sequenceiVSP_002543198 – 236Missing in isoform 2 and isoform 6. CuratedAdd BLAST39
Alternative sequenceiVSP_002542198 – 236DPHFL…HRRLA → ESFGVLGPQVKEPKKT in isoform 3, isoform 7 and isoform 12. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_002540198 – 203DPHFLR → GKFRHV in isoform 9. Curated6
Alternative sequenceiVSP_002541204 – 247Missing in isoform 9. CuratedAdd BLAST44
Alternative sequenceiVSP_002545244 – 247RNPF → LFHLEALSG in isoform 5, isoform 6, isoform 7 and isoform 8. Curated4
Alternative sequenceiVSP_055600245 – 247NPF → KFSSLCYKQRIKSQERETEA TRGRGGLLRDHIPRGKEELE SLGGGKTPPGR in isoform 13. 1 Publication3

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X74511 mRNA Translation: CAA52617.1
Z48051 Genomic DNA Translation: CAA88109.1
U18840 mRNA Translation: AAC50361.1
U18843 mRNA Translation: AAC50362.1
U18798 mRNA Translation: AAC50876.1
U18799 mRNA Translation: AAC50877.1
U18800 mRNA Translation: AAB36870.1
U18801 mRNA Translation: AAC50878.1
U18803 mRNA Translation: AAC50879.1
U64564 mRNA Translation: AAB08088.1
U64565 mRNA Translation: AAB08089.1
U64566 mRNA Translation: AAB08090.1
U64567 mRNA Translation: AAB08091.1
U64568 mRNA Translation: AAB08092.1
U64569 mRNA Translation: AAB08093.1
U64570 mRNA Translation: AAB08094.1
U64571 mRNA Translation: AAB08095.1
AK312892 mRNA Translation: BAG35739.1
AL050328 Genomic DNA Translation: CAB89267.1
AL050328 Genomic DNA Translation: CAB89268.1
AL050328 Genomic DNA Translation: CAB89269.1
AL050328 Genomic DNA Translation: CAB89270.1
AL050328 Genomic DNA Translation: CAB89271.1
AL645936 Genomic DNA No translation available.
AL662826 Genomic DNA No translation available.
AL669813 Genomic DNA No translation available.
AL929591 Genomic DNA No translation available.
BX120002 Genomic DNA No translation available.
BX927250 Genomic DNA No translation available.
CR388408 Genomic DNA No translation available.
CR759766 Genomic DNA No translation available.
CR936483 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03213.1
CH471081 Genomic DNA Translation: EAX03214.1
CH471081 Genomic DNA Translation: EAX03216.1
CH471081 Genomic DNA Translation: EAX03217.1
BC035938 mRNA Translation: AAH35938.1
AY566847 mRNA Translation: AAU09338.1
AY566853 mRNA Translation: AAU09343.1
CCDSiCCDS34366.1 [Q16653-7]
CCDS34367.1 [Q16653-6]
CCDS34368.1 [Q16653-11]
CCDS34369.1 [Q16653-3]
CCDS34370.1 [Q16653-1]
CCDS4667.1 [Q16653-5]
CCDS47394.1 [Q16653-2]
CCDS47395.2 [Q16653-4]
CCDS54977.1 [Q16653-12]
PIRiS58394
RefSeqiNP_001008229.1, NM_001008228.2 [Q16653-3]
NP_001008230.1, NM_001008229.2 [Q16653-11]
NP_001163889.1, NM_001170418.1 [Q16653-12]
NP_002424.3, NM_002433.4 [Q16653-5]
NP_996532.2, NM_206809.3 [Q16653-1]
NP_996533.2, NM_206810.3 [Q16653-6]
NP_996534.2, NM_206811.3 [Q16653-7]
NP_996535.2, NM_206812.3 [Q16653-2]
NP_996537.3, NM_206814.5 [Q16653-4]
XP_005249188.1, XM_005249131.3 [Q16653-13]
UniGeneiHs.141308

Genome annotation databases

EnsembliENST00000259891; ENSP00000259891; ENSG00000137345
ENST00000359539; ENSP00000352534; ENSG00000137345
ENST00000376888; ENSP00000366085; ENSG00000204655 [Q16653-4]
ENST00000376891; ENSP00000366088; ENSG00000204655 [Q16653-11]
ENST00000376894; ENSP00000366091; ENSG00000204655 [Q16653-13]
ENST00000376898; ENSP00000366095; ENSG00000204655 [Q16653-5]
ENST00000376917; ENSP00000366115; ENSG00000204655 [Q16653-1]
ENST00000383521; ENSP00000373013; ENSG00000237834
ENST00000383525; ENSP00000373017; ENSG00000237834
ENST00000383630; ENSP00000373126; ENSG00000137345
ENST00000383631; ENSP00000373127; ENSG00000137345
ENST00000396701; ENSP00000379929; ENSG00000204655 [Q16653-6]
ENST00000396704; ENSP00000379932; ENSG00000204655 [Q16653-3]
ENST00000400669; ENSP00000383510; ENSG00000237834
ENST00000400671; ENSP00000383512; ENSG00000237834
ENST00000400688; ENSP00000383526; ENSG00000137345
ENST00000400691; ENSP00000383528; ENSG00000137345
ENST00000412760; ENSP00000404245; ENSG00000237834
ENST00000414889; ENSP00000403380; ENSG00000234623
ENST00000415546; ENSP00000404149; ENSG00000234096
ENST00000417019; ENSP00000404537; ENSG00000234096
ENST00000419274; ENSP00000411489; ENSG00000236561
ENST00000419309; ENSP00000395005; ENSG00000236561
ENST00000420045; ENSP00000390682; ENSG00000234096
ENST00000423895; ENSP00000390632; ENSG00000230885
ENST00000425145; ENSP00000397101; ENSG00000234623
ENST00000426782; ENSP00000410699; ENSG00000230885
ENST00000427289; ENSP00000414489; ENSG00000230885
ENST00000428719; ENSP00000397723; ENSG00000234096
ENST00000430264; ENSP00000403058; ENSG00000234623
ENST00000430351; ENSP00000410268; ENSG00000234096
ENST00000431798; ENSP00000410866; ENSG00000204655 [Q16653-2]
ENST00000432271; ENSP00000389221; ENSG00000234623
ENST00000433500; ENSP00000413364; ENSG00000236561
ENST00000434177; ENSP00000398197; ENSG00000234623
ENST00000438803; ENSP00000414862; ENSG00000236561
ENST00000439634; ENSP00000404957; ENSG00000234096
ENST00000439884; ENSP00000398394; ENSG00000237834
ENST00000440561; ENSP00000409534; ENSG00000230885
ENST00000442244; ENSP00000391516; ENSG00000236561
ENST00000442444; ENSP00000414146; ENSG00000137345
ENST00000442629; ENSP00000399240; ENSG00000234623
ENST00000444674; ENSP00000390469; ENSG00000230885
ENST00000447285; ENSP00000401609; ENSG00000236561
ENST00000448816; ENSP00000397837; ENSG00000237834
ENST00000449096; ENSP00000391898; ENSG00000234096
ENST00000452233; ENSP00000394873; ENSG00000234623
ENST00000452744; ENSP00000389022; ENSG00000232641
ENST00000457090; ENSP00000415883; ENSG00000236561
ENST00000457626; ENSP00000402139; ENSG00000230885
ENST00000458179; ENSP00000413370; ENSG00000230885
ENST00000490427; ENSP00000420350; ENSG00000204655 [Q16653-12]
ENST00000494692; ENSP00000417405; ENSG00000204655 [Q16653-7]
ENST00000547083; ENSP00000449213; ENSG00000137345
ENST00000548017; ENSP00000448732; ENSG00000234096
ENST00000550849; ENSP00000449683; ENSG00000237834
ENST00000551175; ENSP00000448879; ENSG00000234623
ENST00000551993; ENSP00000446871; ENSG00000230885
ENST00000553111; ENSP00000447099; ENSG00000236561
GeneIDi4340
KEGGihsa:4340
UCSCiuc003nmy.3 human [Q16653-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiMOG_HUMAN
AccessioniPrimary (citable) accession number: Q16653
Secondary accession number(s): A6NDR4
, A6NNJ9, A8MY31, B0UZR9, E9PGF0, F8W9D5, O00713, O00714, O00715, Q13054, Q13055, Q14855, Q29ZN8, Q56UY0, Q5JNX7, Q5JNY1, Q5JNY2, Q5JNY4, Q5SSB5, Q5SSB6, Q5STL9, Q5STM0, Q5STM1, Q5STM2, Q5STM5, Q5SUK5, Q5SUK7, Q5SUK8, Q5SUK9, Q5SUL0, Q5SUL1, Q8IYG5, Q92891, Q92892, Q92893, Q92894, Q92895, Q93053, Q96KU9, Q96KV0, Q96KV1, Q99605
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 11, 2011
Last modified: July 18, 2018
This is version 162 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
  7. UniProtKB entry view manual
    User manual for the UniProtKB entry view

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health