Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 172 (16 Oct 2019)
Sequence version 2 (11 Jan 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Myelin-oligodendrocyte glycoprotein

Gene

MOG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Mediates homophilic cell-cell adhesion (By similarity). Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication.By similarity
(Microbial infection) Acts as a receptor for rubella virus.1 Publication

Caution

Do not confuse myelin-oligodendrocyte glycoprotein (MOG) with oligodendrocyte-myelin glycoprotein (OMG).Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHost cell receptor for virus entry, Receptor
Biological processCell adhesion, Host-virus interaction

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Myelin-oligodendrocyte glycoprotein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MOG
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7197 MOG

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
159465 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q16653

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini30 – 154ExtracellularSequence analysisAdd BLAST125
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei155 – 175HelicalSequence analysisAdd BLAST21
Topological domaini176 – 210CytoplasmicSequence analysisAdd BLAST35
Transmembranei211 – 231HelicalSequence analysisAdd BLAST21
Topological domaini232 – 247ExtracellularSequence analysisAdd BLAST16

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Narcolepsy 7 (NRCLP7)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionNeurological disabling sleep disorder, characterized by excessive daytime sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-movement (REM) sleep, cataplexy, hypnagogic hallucinations, and sleep paralysis. Cataplexy is a sudden loss of muscle tone triggered by emotions, which is the most valuable clinical feature used to diagnose narcolepsy. Human narcolepsy is primarily a sporadically occurring disorder but familial clustering has been observed.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_066415133S → C in NRCLP7. 1 PublicationCorresponds to variant dbSNP:rs387906655EnsemblClinVar.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
4340

MalaCards human disease database

More...
MalaCardsi
MOG
MIMi614250 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000204655

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
2073 Narcolepsy type 1

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30905

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q16653

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MOG

Domain mapping of disease mutations (DMDM)

More...
DMDMi
317373391

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 29Sequence analysisAdd BLAST29
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001488830 – 247Myelin-oligodendrocyte glycoproteinAdd BLAST218

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi53 ↔ 127PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi60N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q16653

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q16653

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q16653

PeptideAtlas

More...
PeptideAtlasi
Q16653

PRoteomics IDEntifications database

More...
PRIDEi
Q16653

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
20308
30306
61003 [Q16653-1]
61004 [Q16653-10]
61005 [Q16653-2]
61006 [Q16653-3]
61007 [Q16653-4]
61008 [Q16653-5]
61009 [Q16653-6]
61010 [Q16653-7]
61011 [Q16653-8]
61012 [Q16653-9]
63907
63921
71170

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q16653

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q16653

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q16653

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000204655 Expressed in 113 organ(s), highest expression level in C1 segment of cervical spinal cord

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q16653 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q16653 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA021873

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer (By similarity). May form heterodimers between the different isoforms (By similarity).

By similarity

(Microbial infection) Interacts with rubella virus E2 glycoprotein.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110482, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q16653, 3 interactors

Molecular INTeraction database

More...
MINTi
Q16653

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000366095

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q16653

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini32 – 145Ig-like V-typeAdd BLAST114

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IKKW Eukaryota
ENOG41119UE LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153527

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000139597

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q16653

KEGG Orthology (KO)

More...
KOi
K17270

Identification of Orthologs from Complete Genome Data

More...
OMAi
CWKVALF

Database of Orthologous Groups

More...
OrthoDBi
1094524at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q16653

TreeFam database of animal gene trees

More...
TreeFami
TF331083

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
IPR016663 Myelin-oligodendrocyte_glycop

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07686 V-set, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF016522 MOG, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00409 IG, 1 hit
SM00406 IGv, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726 SSF48726, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50835 IG_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (13+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 13 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 13 described isoforms and 15 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q16653-1) [UniParc]FASTAAdd to basket
Also known as: Alpha-1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASLSRPSLP SCLCSFLLLL LLQVSSSYAG QFRVIGPRHP IRALVGDEVE
60 70 80 90 100
LPCRISPGKN ATGMEVGWYR PPFSRVVHLY RNGKDQDGDQ APEYRGRTEL
110 120 130 140 150
LKDAIGEGKV TLRIRNVRFS DEGGFTCFFR DHSYQEEAAM ELKVEDPFYW
160 170 180 190 200
VSPGVLVLLA VLPVLLLQIT VGLIFLCLQY RLRGKLRAEI ENLHRTFDPH
210 220 230 240
FLRVPCWKIT LFVIVPVLGP LVALIICYNW LHRRLAGQFL EELRNPF
Length:247
Mass (Da):28,193
Last modified:January 11, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i846EBA5D412C080C
GO
Isoform 2 (identifier: Q16653-2) [UniParc]FASTAAdd to basket
Also known as: Alpha-2

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: Missing.

Show »
Length:208
Mass (Da):23,627
Checksum:i8053FA07957A1963
GO
Isoform 3 (identifier: Q16653-3) [UniParc]FASTAAdd to basket
Also known as: Alpha-3

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT

Show »
Length:224
Mass (Da):25,353
Checksum:iEF7BA1567A69FB33
GO
Isoform 4 (identifier: Q16653-4) [UniParc]FASTAAdd to basket
Also known as: Alpha-4

The sequence of this isoform differs from the canonical sequence as follows:
     30-145: Missing.

Show »
Length:131
Mass (Da):14,988
Checksum:i80B843738BF1ED47
GO
Isoform 5 (identifier: Q16653-5) [UniParc]FASTAAdd to basket
Also known as: Beta-1

The sequence of this isoform differs from the canonical sequence as follows:
     244-247: RNPF → LFHLEALSG

Show »
Length:252
Mass (Da):28,647
Checksum:iD41E3A6050BA9837
GO
Isoform 6 (identifier: Q16653-6) [UniParc]FASTAAdd to basket
Also known as: Beta-2

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: Missing.
     244-247: RNPF → LFHLEALSG

Show »
Length:213
Mass (Da):24,081
Checksum:iAD5788DAB32EA577
GO
Isoform 7 (identifier: Q16653-7) [UniParc]FASTAAdd to basket
Also known as: Beta-3

The sequence of this isoform differs from the canonical sequence as follows:
     198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT
     244-247: RNPF → LFHLEALSG

Show »
Length:229
Mass (Da):25,807
Checksum:iDB6C018BA4418D2C
GO
Isoform 8 (identifier: Q16653-8) [UniParc]FASTAAdd to basket
Also known as: Beta-4

The sequence of this isoform differs from the canonical sequence as follows:
     198-243: Missing.
     244-247: RNPF → LFHLEALSG

Show »
Length:206
Mass (Da):23,264
Checksum:i54D1257CD963AD8E
GO
Isoform 9 (identifier: Q16653-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     198-203: DPHFLR → GKFRHV
     204-247: Missing.

Note: Not functionally active. May be expressed at low level in the adult.
Show »
Length:203
Mass (Da):23,021
Checksum:i33C38085A4D22627
GO
Isoform 10 (identifier: Q16653-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     146-171: DPFYWVSPGVLVLLAVLPVLLLQITV → VSHSVTQDWLQWHDHGSLQPPPPRLK
     172-247: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:171
Mass (Da):19,334
Checksum:iE65BA3858848F8E8
GO
Isoform 11 (identifier: Q16653-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     198-247: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF → VFHLEALSG

Show »
Length:206
Mass (Da):23,250
Checksum:i4823257CD963AD8E
GO
Isoform 12 (identifier: Q16653-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     30-145: Missing.
     198-236: DPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLA → ESFGVLGPQVKEPKKT

Show »
Length:108
Mass (Da):12,149
Checksum:iEB06EC1E6C59C842
GO
Isoform 13 (identifier: Q16653-13) [UniParc]FASTAAdd to basket
Also known as: X1

The sequence of this isoform differs from the canonical sequence as follows:
     245-247: NPF → KFSSLCYKQRIKSQERETEATRGRGGLLRDHIPRGKEELESLGGGKTPPGR

Note: No experimental confirmation available.
Show »
Length:295
Mass (Da):33,528
Checksum:i2310179859868716
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 15 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5SSB8Q5SSB8_HUMAN
Myelin-oligodendrocyte glycoprotein
MOG hCG_25629
252Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JTE0C9JTE0_HUMAN
Myelin-oligodendrocyte glycoprotein
MOG
209Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JHA9A0A0G2JHA9_HUMAN
Myelin-oligodendrocyte glycoprotein
MOG
224Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JIQ0A0A0G2JIQ0_HUMAN
Myelin-oligodendrocyte glycoprotein
MOG
252Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JIU9A0A0G2JIU9_HUMAN
Myelin-oligodendrocyte glycoprotein
MOG
213Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JKI0A0A0G2JKI0_HUMAN
Myelin-oligodendrocyte glycoprotein
MOG
229Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JHM8A0A0G2JHM8_HUMAN
Myelin-oligodendrocyte glycoprotein
MOG
295Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JI49A0A0G2JI49_HUMAN
Myelin-oligodendrocyte glycoprotein
MOG
204Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PG44E9PG44_HUMAN
Myelin-oligodendrocyte glycoprotein
MOG
92Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JHB7A0A0G2JHB7_HUMAN
Myelin-oligodendrocyte glycoprotein
MOG
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_066415133S → C in NRCLP7. 1 PublicationCorresponds to variant dbSNP:rs387906655EnsemblClinVar.1
Natural variantiVAR_056056171V → L2 PublicationsCorresponds to variant dbSNP:rs2857766Ensembl.1
Natural variantiVAR_060215174I → V10 PublicationsCorresponds to variant dbSNP:rs3130253Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00253930 – 145Missing in isoform 4 and isoform 12. 1 PublicationAdd BLAST116
Alternative sequenceiVSP_040344146 – 171DPFYW…LQITV → VSHSVTQDWLQWHDHGSLQP PPPRLK in isoform 10. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_040345172 – 247Missing in isoform 10. 1 PublicationAdd BLAST76
Alternative sequenceiVSP_046856198 – 247DPHFL…LRNPF → VFHLEALSG in isoform 11. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_002544198 – 243Missing in isoform 8. CuratedAdd BLAST46
Alternative sequenceiVSP_002543198 – 236Missing in isoform 2 and isoform 6. CuratedAdd BLAST39
Alternative sequenceiVSP_002542198 – 236DPHFL…HRRLA → ESFGVLGPQVKEPKKT in isoform 3, isoform 7 and isoform 12. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_002540198 – 203DPHFLR → GKFRHV in isoform 9. Curated6
Alternative sequenceiVSP_002541204 – 247Missing in isoform 9. CuratedAdd BLAST44
Alternative sequenceiVSP_002545244 – 247RNPF → LFHLEALSG in isoform 5, isoform 6, isoform 7 and isoform 8. Curated4
Alternative sequenceiVSP_055600245 – 247NPF → KFSSLCYKQRIKSQERETEA TRGRGGLLRDHIPRGKEELE SLGGGKTPPGR in isoform 13. 1 Publication3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X74511 mRNA Translation: CAA52617.1
Z48051 Genomic DNA Translation: CAA88109.1
U18840 mRNA Translation: AAC50361.1
U18843 mRNA Translation: AAC50362.1
U18798 mRNA Translation: AAC50876.1
U18799 mRNA Translation: AAC50877.1
U18800 mRNA Translation: AAB36870.1
U18801 mRNA Translation: AAC50878.1
U18803 mRNA Translation: AAC50879.1
U64564 mRNA Translation: AAB08088.1
U64565 mRNA Translation: AAB08089.1
U64566 mRNA Translation: AAB08090.1
U64567 mRNA Translation: AAB08091.1
U64568 mRNA Translation: AAB08092.1
U64569 mRNA Translation: AAB08093.1
U64570 mRNA Translation: AAB08094.1
U64571 mRNA Translation: AAB08095.1
AK312892 mRNA Translation: BAG35739.1
AL050328 Genomic DNA Translation: CAB89267.1
AL050328 Genomic DNA Translation: CAB89268.1
AL050328 Genomic DNA Translation: CAB89269.1
AL050328 Genomic DNA Translation: CAB89270.1
AL050328 Genomic DNA Translation: CAB89271.1
AL645936 Genomic DNA No translation available.
AL662826 Genomic DNA No translation available.
AL669813 Genomic DNA No translation available.
AL929591 Genomic DNA No translation available.
BX120002 Genomic DNA No translation available.
BX927250 Genomic DNA No translation available.
CR388408 Genomic DNA No translation available.
CR759766 Genomic DNA No translation available.
CR936483 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03213.1
CH471081 Genomic DNA Translation: EAX03214.1
CH471081 Genomic DNA Translation: EAX03216.1
CH471081 Genomic DNA Translation: EAX03217.1
BC035938 mRNA Translation: AAH35938.1
AY566847 mRNA Translation: AAU09338.1
AY566853 mRNA Translation: AAU09343.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34366.1 [Q16653-7]
CCDS34367.1 [Q16653-6]
CCDS34368.1 [Q16653-11]
CCDS34369.1 [Q16653-3]
CCDS34370.1 [Q16653-1]
CCDS4667.1 [Q16653-5]
CCDS47394.1 [Q16653-2]
CCDS47395.2 [Q16653-4]
CCDS54977.1 [Q16653-12]
CCDS87379.1 [Q16653-13]

Protein sequence database of the Protein Information Resource

More...
PIRi
S58394

NCBI Reference Sequences

More...
RefSeqi
NP_001008229.1, NM_001008228.2 [Q16653-3]
NP_001008230.1, NM_001008229.2 [Q16653-11]
NP_001163889.1, NM_001170418.1 [Q16653-12]
NP_002424.3, NM_002433.4 [Q16653-5]
NP_996532.2, NM_206809.3 [Q16653-1]
NP_996533.2, NM_206810.3 [Q16653-6]
NP_996534.2, NM_206811.3 [Q16653-7]
NP_996535.2, NM_206812.3 [Q16653-2]
NP_996537.3, NM_206814.5 [Q16653-4]
XP_005249188.1, XM_005249131.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000259891; ENSP00000259891; ENSG00000137345
ENST00000359539; ENSP00000352534; ENSG00000137345
ENST00000376888; ENSP00000366085; ENSG00000204655 [Q16653-4]
ENST00000376891; ENSP00000366088; ENSG00000204655 [Q16653-11]
ENST00000376894; ENSP00000366091; ENSG00000204655 [Q16653-13]
ENST00000376898; ENSP00000366095; ENSG00000204655 [Q16653-5]
ENST00000376917; ENSP00000366115; ENSG00000204655 [Q16653-1]
ENST00000383521; ENSP00000373013; ENSG00000237834
ENST00000383525; ENSP00000373017; ENSG00000237834
ENST00000383630; ENSP00000373126; ENSG00000137345
ENST00000383631; ENSP00000373127; ENSG00000137345
ENST00000396701; ENSP00000379929; ENSG00000204655 [Q16653-6]
ENST00000396704; ENSP00000379932; ENSG00000204655 [Q16653-3]
ENST00000400669; ENSP00000383510; ENSG00000237834
ENST00000400671; ENSP00000383512; ENSG00000237834
ENST00000400688; ENSP00000383526; ENSG00000137345
ENST00000400691; ENSP00000383528; ENSG00000137345
ENST00000412760; ENSP00000404245; ENSG00000237834
ENST00000414889; ENSP00000403380; ENSG00000234623
ENST00000415546; ENSP00000404149; ENSG00000234096
ENST00000417019; ENSP00000404537; ENSG00000234096
ENST00000419274; ENSP00000411489; ENSG00000236561
ENST00000419309; ENSP00000395005; ENSG00000236561
ENST00000420045; ENSP00000390682; ENSG00000234096
ENST00000423895; ENSP00000390632; ENSG00000230885
ENST00000425145; ENSP00000397101; ENSG00000234623
ENST00000426782; ENSP00000410699; ENSG00000230885
ENST00000427289; ENSP00000414489; ENSG00000230885
ENST00000428719; ENSP00000397723; ENSG00000234096
ENST00000430264; ENSP00000403058; ENSG00000234623
ENST00000430351; ENSP00000410268; ENSG00000234096
ENST00000431798; ENSP00000410866; ENSG00000204655 [Q16653-2]
ENST00000432271; ENSP00000389221; ENSG00000234623
ENST00000433500; ENSP00000413364; ENSG00000236561
ENST00000434177; ENSP00000398197; ENSG00000234623
ENST00000438803; ENSP00000414862; ENSG00000236561
ENST00000439634; ENSP00000404957; ENSG00000234096
ENST00000439884; ENSP00000398394; ENSG00000237834
ENST00000440561; ENSP00000409534; ENSG00000230885
ENST00000442244; ENSP00000391516; ENSG00000236561
ENST00000442444; ENSP00000414146; ENSG00000137345
ENST00000442629; ENSP00000399240; ENSG00000234623
ENST00000444674; ENSP00000390469; ENSG00000230885
ENST00000447285; ENSP00000401609; ENSG00000236561
ENST00000448816; ENSP00000397837; ENSG00000237834
ENST00000449096; ENSP00000391898; ENSG00000234096
ENST00000452233; ENSP00000394873; ENSG00000234623
ENST00000452744; ENSP00000389022; ENSG00000232641
ENST00000457090; ENSP00000415883; ENSG00000236561
ENST00000457626; ENSP00000402139; ENSG00000230885
ENST00000458179; ENSP00000413370; ENSG00000230885
ENST00000490427; ENSP00000420350; ENSG00000204655 [Q16653-12]
ENST00000494692; ENSP00000417405; ENSG00000204655 [Q16653-7]
ENST00000547083; ENSP00000449213; ENSG00000137345
ENST00000548017; ENSP00000448732; ENSG00000234096
ENST00000550849; ENSP00000449683; ENSG00000237834
ENST00000551175; ENSP00000448879; ENSG00000234623
ENST00000551993; ENSP00000446871; ENSG00000230885
ENST00000553111; ENSP00000447099; ENSG00000236561

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4340

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4340

UCSC genome browser

More...
UCSCi
uc003nmy.3 human [Q16653-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Myelin oligodendrocyte glycoprotein entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X74511 mRNA Translation: CAA52617.1
Z48051 Genomic DNA Translation: CAA88109.1
U18840 mRNA Translation: AAC50361.1
U18843 mRNA Translation: AAC50362.1
U18798 mRNA Translation: AAC50876.1
U18799 mRNA Translation: AAC50877.1
U18800 mRNA Translation: AAB36870.1
U18801 mRNA Translation: AAC50878.1
U18803 mRNA Translation: AAC50879.1
U64564 mRNA Translation: AAB08088.1
U64565 mRNA Translation: AAB08089.1
U64566 mRNA Translation: AAB08090.1
U64567 mRNA Translation: AAB08091.1
U64568 mRNA Translation: AAB08092.1
U64569 mRNA Translation: AAB08093.1
U64570 mRNA Translation: AAB08094.1
U64571 mRNA Translation: AAB08095.1
AK312892 mRNA Translation: BAG35739.1
AL050328 Genomic DNA Translation: CAB89267.1
AL050328 Genomic DNA Translation: CAB89268.1
AL050328 Genomic DNA Translation: CAB89269.1
AL050328 Genomic DNA Translation: CAB89270.1
AL050328 Genomic DNA Translation: CAB89271.1
AL645936 Genomic DNA No translation available.
AL662826 Genomic DNA No translation available.
AL669813 Genomic DNA No translation available.
AL929591 Genomic DNA No translation available.
BX120002 Genomic DNA No translation available.
BX927250 Genomic DNA No translation available.
CR388408 Genomic DNA No translation available.
CR759766 Genomic DNA No translation available.
CR936483 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03213.1
CH471081 Genomic DNA Translation: EAX03214.1
CH471081 Genomic DNA Translation: EAX03216.1
CH471081 Genomic DNA Translation: EAX03217.1
BC035938 mRNA Translation: AAH35938.1
AY566847 mRNA Translation: AAU09338.1
AY566853 mRNA Translation: AAU09343.1
CCDSiCCDS34366.1 [Q16653-7]
CCDS34367.1 [Q16653-6]
CCDS34368.1 [Q16653-11]
CCDS34369.1 [Q16653-3]
CCDS34370.1 [Q16653-1]
CCDS4667.1 [Q16653-5]
CCDS47394.1 [Q16653-2]
CCDS47395.2 [Q16653-4]
CCDS54977.1 [Q16653-12]
CCDS87379.1 [Q16653-13]
PIRiS58394
RefSeqiNP_001008229.1, NM_001008228.2 [Q16653-3]
NP_001008230.1, NM_001008229.2 [Q16653-11]
NP_001163889.1, NM_001170418.1 [Q16653-12]
NP_002424.3, NM_002433.4 [Q16653-5]
NP_996532.2, NM_206809.3 [Q16653-1]
NP_996533.2, NM_206810.3 [Q16653-6]
NP_996534.2, NM_206811.3 [Q16653-7]
NP_996535.2, NM_206812.3 [Q16653-2]
NP_996537.3, NM_206814.5 [Q16653-4]
XP_005249188.1, XM_005249131.3

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1Q70model-A31-149[»]
SMRiQ16653
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi110482, 1 interactor
IntActiQ16653, 3 interactors
MINTiQ16653
STRINGi9606.ENSP00000366095

PTM databases

iPTMnetiQ16653
PhosphoSitePlusiQ16653
SwissPalmiQ16653

Polymorphism and mutation databases

BioMutaiMOG
DMDMi317373391

Proteomic databases

jPOSTiQ16653
MassIVEiQ16653
PaxDbiQ16653
PeptideAtlasiQ16653
PRIDEiQ16653
ProteomicsDBi20308
30306
61003 [Q16653-1]
61004 [Q16653-10]
61005 [Q16653-2]
61006 [Q16653-3]
61007 [Q16653-4]
61008 [Q16653-5]
61009 [Q16653-6]
61010 [Q16653-7]
61011 [Q16653-8]
61012 [Q16653-9]
63907
63921
71170

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
4340

Genome annotation databases

EnsembliENST00000259891; ENSP00000259891; ENSG00000137345
ENST00000359539; ENSP00000352534; ENSG00000137345
ENST00000376888; ENSP00000366085; ENSG00000204655 [Q16653-4]
ENST00000376891; ENSP00000366088; ENSG00000204655 [Q16653-11]
ENST00000376894; ENSP00000366091; ENSG00000204655 [Q16653-13]
ENST00000376898; ENSP00000366095; ENSG00000204655 [Q16653-5]
ENST00000376917; ENSP00000366115; ENSG00000204655 [Q16653-1]
ENST00000383521; ENSP00000373013; ENSG00000237834
ENST00000383525; ENSP00000373017; ENSG00000237834
ENST00000383630; ENSP00000373126; ENSG00000137345
ENST00000383631; ENSP00000373127; ENSG00000137345
ENST00000396701; ENSP00000379929; ENSG00000204655 [Q16653-6]
ENST00000396704; ENSP00000379932; ENSG00000204655 [Q16653-3]
ENST00000400669; ENSP00000383510; ENSG00000237834
ENST00000400671; ENSP00000383512; ENSG00000237834
ENST00000400688; ENSP00000383526; ENSG00000137345
ENST00000400691; ENSP00000383528; ENSG00000137345
ENST00000412760; ENSP00000404245; ENSG00000237834
ENST00000414889; ENSP00000403380; ENSG00000234623
ENST00000415546; ENSP00000404149; ENSG00000234096
ENST00000417019; ENSP00000404537; ENSG00000234096
ENST00000419274; ENSP00000411489; ENSG00000236561
ENST00000419309; ENSP00000395005; ENSG00000236561
ENST00000420045; ENSP00000390682; ENSG00000234096
ENST00000423895; ENSP00000390632; ENSG00000230885
ENST00000425145; ENSP00000397101; ENSG00000234623
ENST00000426782; ENSP00000410699; ENSG00000230885
ENST00000427289; ENSP00000414489; ENSG00000230885
ENST00000428719; ENSP00000397723; ENSG00000234096
ENST00000430264; ENSP00000403058; ENSG00000234623
ENST00000430351; ENSP00000410268; ENSG00000234096
ENST00000431798; ENSP00000410866; ENSG00000204655 [Q16653-2]
ENST00000432271; ENSP00000389221; ENSG00000234623
ENST00000433500; ENSP00000413364; ENSG00000236561
ENST00000434177; ENSP00000398197; ENSG00000234623
ENST00000438803; ENSP00000414862; ENSG00000236561
ENST00000439634; ENSP00000404957; ENSG00000234096
ENST00000439884; ENSP00000398394; ENSG00000237834
ENST00000440561; ENSP00000409534; ENSG00000230885
ENST00000442244; ENSP00000391516; ENSG00000236561
ENST00000442444; ENSP00000414146; ENSG00000137345
ENST00000442629; ENSP00000399240; ENSG00000234623
ENST00000444674; ENSP00000390469; ENSG00000230885
ENST00000447285; ENSP00000401609; ENSG00000236561
ENST00000448816; ENSP00000397837; ENSG00000237834
ENST00000449096; ENSP00000391898; ENSG00000234096
ENST00000452233; ENSP00000394873; ENSG00000234623
ENST00000452744; ENSP00000389022; ENSG00000232641
ENST00000457090; ENSP00000415883; ENSG00000236561
ENST00000457626; ENSP00000402139; ENSG00000230885
ENST00000458179; ENSP00000413370; ENSG00000230885
ENST00000490427; ENSP00000420350; ENSG00000204655 [Q16653-12]
ENST00000494692; ENSP00000417405; ENSG00000204655 [Q16653-7]
ENST00000547083; ENSP00000449213; ENSG00000137345
ENST00000548017; ENSP00000448732; ENSG00000234096
ENST00000550849; ENSP00000449683; ENSG00000237834
ENST00000551175; ENSP00000448879; ENSG00000234623
ENST00000551993; ENSP00000446871; ENSG00000230885
ENST00000553111; ENSP00000447099; ENSG00000236561
GeneIDi4340
KEGGihsa:4340
UCSCiuc003nmy.3 human [Q16653-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4340
DisGeNETi4340

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MOG
HGNCiHGNC:7197 MOG
HPAiHPA021873
MalaCardsiMOG
MIMi159465 gene
614250 phenotype
neXtProtiNX_Q16653
OpenTargetsiENSG00000204655
Orphaneti2073 Narcolepsy type 1
PharmGKBiPA30905

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IKKW Eukaryota
ENOG41119UE LUCA
GeneTreeiENSGT00940000153527
HOGENOMiHOG000139597
InParanoidiQ16653
KOiK17270
OMAiCWKVALF
OrthoDBi1094524at2759
PhylomeDBiQ16653
TreeFamiTF331083

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MOG human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Myelin_oligodendrocyte_glycoprotein

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4340
PharosiQ16653

Protein Ontology

More...
PROi
PR:Q16653

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000204655 Expressed in 113 organ(s), highest expression level in C1 segment of cervical spinal cord
ExpressionAtlasiQ16653 baseline and differential
GenevisibleiQ16653 HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
IPR016663 Myelin-oligodendrocyte_glycop
PfamiView protein in Pfam
PF07686 V-set, 1 hit
PIRSFiPIRSF016522 MOG, 1 hit
SMARTiView protein in SMART
SM00409 IG, 1 hit
SM00406 IGv, 1 hit
SUPFAMiSSF48726 SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMOG_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q16653
Secondary accession number(s): A6NDR4
, A6NNJ9, A8MY31, B0UZR9, E9PGF0, F8W9D5, O00713, O00714, O00715, Q13054, Q13055, Q14855, Q29ZN8, Q56UY0, Q5JNX7, Q5JNY1, Q5JNY2, Q5JNY4, Q5SSB5, Q5SSB6, Q5STL9, Q5STM0, Q5STM1, Q5STM2, Q5STM5, Q5SUK5, Q5SUK7, Q5SUK8, Q5SUK9, Q5SUL0, Q5SUL1, Q8IYG5, Q92891, Q92892, Q92893, Q92894, Q92895, Q93053, Q96KU9, Q96KV0, Q96KV1, Q99605
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 11, 2011
Last modified: October 16, 2019
This is version 172 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. UniProtKB entry view manual
    User manual for the UniProtKB entry view
  7. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again