Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Occludin

Gene

OCLN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. It is able to induce adhesion when expressed in cells lacking tight junctions.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • protein domain specific binding Source: UniProtKB

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-351906 Apoptotic cleavage of cell adhesion proteins
R-HSA-8935964 RUNX1 regulates expression of components of tight junctions

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q16625

Protein family/group databases

Transport Classification Database

More...
TCDBi
9.B.41.1.1 the occludin (occludin) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Occludin
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:OCLN
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000197822.10

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8104 OCLN

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602876 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q16625

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 66CytoplasmicSequence analysisAdd BLAST66
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei67 – 89HelicalSequence analysisAdd BLAST23
Topological domaini90 – 135Extracellular1 PublicationAdd BLAST46
Transmembranei136 – 160HelicalSequence analysisAdd BLAST25
Topological domaini161 – 170CytoplasmicSequence analysis10
Transmembranei171 – 195HelicalSequence analysisAdd BLAST25
Topological domaini196 – 243ExtracellularSequence analysisAdd BLAST48
Transmembranei244 – 265HelicalSequence analysisAdd BLAST22
Topological domaini266 – 522CytoplasmicSequence analysisAdd BLAST257

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Tight junction

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Pseudo-TORCH syndrome 1 (PTORCH1)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive neurologic disorder with characteristic clinical and neuroradiologic features that mimic intrauterine TORCH infection in the absence of evidence of infection. Affected individuals have congenital microcephaly, intracranial calcifications, and severe developmental delay.
See also OMIM:251290
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_064910219F → S in PTORCH1. 1 PublicationCorresponds to variant dbSNP:rs267606926EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi398Y → A: Loss of phosphorylation and loss of regulation of TJP1 binding; when associated with A-402. 1 Publication1
Mutagenesisi398Y → D: Loss of phosphorylation, almost complete loss of binding to TJP1, loss of regulation of TJP1 binding and loss of localization to plasma membrane and sites of cell-cell contact; when associated with D-402. 1 Publication1
Mutagenesisi398Y → F: Loss of phosphorylation, decrease in binding to TJP1 and significant loss of regulation of TJP1 binding; when associated with F-402. 1 Publication1
Mutagenesisi402Y → A: Loss of phosphorylation and loss of regulation of TJP1 binding; when associated with A-398. 1 Publication1
Mutagenesisi402Y → D: Loss of phosphorylation, almost complete loss of binding to TJP1, loss of regulation of TJP1 binding and loss of localization to plasma membrane and sites of cell-cell contact; when associated with D-398. 1 Publication1
Mutagenesisi402Y → F: Loss of phosphorylation, decrease in binding to TJP1 and significant loss of regulation of TJP1 binding; when associated with F-398. 1 Publication1
Mutagenesisi404T → A: Loss of localization to the tight junctions. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
100506658

MalaCards human disease database

More...
MalaCardsi
OCLN
MIMi251290 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000197822

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
1229 Congenital intrauterine infection-like syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31893

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
OCLN

Domain mapping of disease mutations (DMDM)

More...
DMDMi
3914196

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001467391 – 522OccludinAdd BLAST522

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi216 ↔ 2371 Publication
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei302PhosphoserineBy similarity1
Modified residuei305PhosphothreonineBy similarity1
Modified residuei313PhosphoserineCombined sources1
Modified residuei321PhosphoserineCombined sources1
Modified residuei340PhosphoserineBy similarity1
Modified residuei368PhosphotyrosineCombined sources1
Modified residuei369PhosphoserineCombined sources1
Modified residuei370PhosphoserineCombined sources1
Modified residuei398Phosphotyrosine1 Publication1
Modified residuei402Phosphotyrosine1 Publication1
Modified residuei403Phosphothreonine; by PKC/PRKCH1 Publication1
Modified residuei404Phosphothreonine; by PKC/PRKCH1 Publication1
Modified residuei408PhosphoserineCombined sources1
Modified residuei490Phosphoserine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Dephosphorylated by PTPRJ. The tyrosine phosphorylation on Tyr-398 and Tyr-402 reduces its ability to interact with TJP1. Phosphorylation at Ser-490 also attenuates the interaction with TJP1.4 Publications

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q16625

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q16625

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q16625

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q16625

PeptideAtlas

More...
PeptideAtlasi
Q16625

PRoteomics IDEntifications database

More...
PRIDEi
Q16625

ProteomicsDB human proteome resource

More...
ProteomicsDBi
60966
60967 [Q16625-2]
60968 [Q16625-3]
60969 [Q16625-4]
60970 [Q16625-5]
60971 [Q16625-6]
60972 [Q16625-7]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q16625-3 [Q16625-3]
Q16625-6 [Q16625-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q16625

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q16625

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
Q16625

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Localized at tight junctions of both epithelial and endothelial cells. Highly expressed in kidney. Not detected in testis.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000197822 Expressed in 197 organ(s), highest expression level in thyroid gland

CleanEx database of gene expression profiles

More...
CleanExi
HS_OCLN

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q16625 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB013075
CAB068212
CAB068213
CAB068214
HPA005933

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with TJP1/ZO1 (PubMed:19017651). Interacts with VAPA (PubMed:10523508). Interacts with CLDN1, CLDN6, CLDN9, CLDN11, CLDN12 and CLDN17 (PubMed:20375010).3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111004, 68 interactors

Database of interacting proteins

More...
DIPi
DIP-42791N

Protein interaction database and analysis system

More...
IntActi
Q16625, 18 interactors

Molecular INTeraction database

More...
MINTi
Q16625

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000347379

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1522
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WPAX-ray1.50A413-522[»]
1XAWX-ray1.45A383-522[»]
3G7CX-ray2.00A416-522[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q16625

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q16625

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q16625

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini60 – 269MARVELPROSITE-ProRule annotationAdd BLAST210

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili426 – 489Sequence analysisAdd BLAST64

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi92 – 131Gly/Tyr-richAdd BLAST40

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The C-terminal is cytoplasmic and is important for interaction with ZO-1. Sufficient for the tight junction localization. Involved in the regulation of the permeability barrier function of the tight junction (By similarity). The first extracellular loop participates in an adhesive interaction.By similarity1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ELL/occludin family.Curated

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGK8 Eukaryota
ENOG4110E0E LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00730000110989

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000233490

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG004523

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q16625

KEGG Orthology (KO)

More...
KOi
K06088

Identification of Orthologs from Complete Genome Data

More...
OMAi
YAPSNDM

Database of Orthologous Groups

More...
OrthoDBi
710557at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q16625

TreeFam database of animal gene trees

More...
TreeFami
TF326161

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR031176 ELL/occludin
IPR008253 Marvel
IPR036259 MFS_trans_sf
IPR002958 Occludin
IPR010844 Occludin_ELL

The PANTHER Classification System

More...
PANTHERi
PTHR23288 PTHR23288, 1 hit
PTHR23288:SF4 PTHR23288:SF4, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01284 MARVEL, 1 hit
PF07303 Occludin_ELL, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF005993 Occludin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01258 OCCLUDIN

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF103473 SSF103473, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51225 MARVEL, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q16625-1) [UniParc]FASTAAdd to basket
Also known as: WT-OCLN, TM4(+)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSRPLESPP PYRPDEFKPN HYAPSNDIYG GEMHVRPMLS QPAYSFYPED
60 70 80 90 100
EILHFYKWTS PPGVIRILSM LIIVMCIAIF ACVASTLAWD RGYGTSLLGG
110 120 130 140 150
SVGYPYGGSG FGSYGSGYGY GYGYGYGYGG YTDPRAAKGF MLAMAAFCFI
160 170 180 190 200
AALVIFVTSV IRSEMSRTRR YYLSVIIVSA ILGIMVFIAT IVYIMGVNPT
210 220 230 240 250
AQSSGSLYGS QIYALCNQFY TPAATGLYVD QYLYHYCVVD PQEAIAIVLG
260 270 280 290 300
FMIIVAFALI IFFAVKTRRK MDRYDKSNIL WDKEHIYDEQ PPNVEEWVKN
310 320 330 340 350
VSAGTQDVPS PPSDYVERVD SPMAYSSNGK VNDKRFYPES SYKSTPVPEV
360 370 380 390 400
VQELPLTSPV DDFRQPRYSS GGNFETPSKR APAKGRAGRS KRTEQDHYET
410 420 430 440 450
DYTTGGESCD ELEEDWIREY PPITSDQQRQ LYKRNFDTGL QEYKSLQSEL
460 470 480 490 500
DEINKELSRL DKELDDYREE SEEYMAAADE YNRLKQVKGS ADYKSKKNHC
510 520
KQLKSKLSHI KKMVGDYDRQ KT
Length:522
Mass (Da):59,144
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA0CF9574BCF6E974
GO
Isoform 2 (identifier: Q16625-2) [UniParc]FASTAAdd to basket
Also known as: OCLN-ex4del, TM4(-)

The sequence of this isoform differs from the canonical sequence as follows:
     244-297: Missing.

Show »
Length:468
Mass (Da):52,706
Checksum:i570C03F39D5B9F09
GO
Isoform 3 (identifier: Q16625-3) [UniParc]FASTAAdd to basket
Also known as: OCLN-ex7ext

The sequence of this isoform differs from the canonical sequence as follows:
     476-522: AAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT → VNST

Show »
Length:479
Mass (Da):54,124
Checksum:iBAC5CDCFD4AB3FE9
GO
Isoform 4 (identifier: Q16625-4) [UniParc]FASTAAdd to basket
Also known as: OCLN-ex3del, OCLN-ex3pdel

The sequence of this isoform differs from the canonical sequence as follows:
     1-251: Missing.

Show »
Length:271
Mass (Da):31,602
Checksum:i17110B0747658560
GO
Isoform 5 (identifier: Q16625-5) [UniParc]FASTAAdd to basket
Also known as: OCLN-ex3-4del

The sequence of this isoform differs from the canonical sequence as follows:
     1-251: Missing.
     252-322: Missing.

Show »
Length:200
Mass (Da):23,324
Checksum:iCA521768CF62815F
GO
Isoform 6 (identifier: Q16625-6) [UniParc]FASTAAdd to basket
Also known as: OCLN-ex3p-9pdel

The sequence of this isoform differs from the canonical sequence as follows:
     50-69: DEILHFYKWTSPPGVIRILS → ESLQAVKEQIVTHQEDGWRL
     70-70: Missing.
     71-522: Missing.

Show »
Length:69
Mass (Da):8,033
Checksum:i44E322DFFA119B8E
GO
Isoform 7 (identifier: Q16625-7) [UniParc]FASTAAdd to basket
Also known as: OCLN-ex3p-7pdel

The sequence of this isoform differs from the canonical sequence as follows:
     52-70: ILHFYKWTSPPGVIRILSM → MTIEKKVKSTWLLLMNTID
     71-522: Missing.

Show »
Length:70
Mass (Da):8,175
Checksum:iFF4DA5B4703A5BAD
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0G2JMZ8A0A0G2JMZ8_HUMAN
Occludin
OCLN
522Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JPF2A0A0G2JPF2_HUMAN
Occludin
OCLN
130Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti233L → S in AAH29886 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_064910219F → S in PTORCH1. 1 PublicationCorresponds to variant dbSNP:rs267606926EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0438721 – 251Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST251
Alternative sequenceiVSP_04387350 – 69DEILH…IRILS → ESLQAVKEQIVTHQEDGWRL in isoform 6. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_04387452 – 70ILHFY…RILSM → MTIEKKVKSTWLLLMNTID in isoform 7. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_04387570Missing in isoform 6. 1 Publication1
Alternative sequenceiVSP_04387671 – 522Missing in isoform 6 and isoform 7. 1 PublicationAdd BLAST452
Alternative sequenceiVSP_043877244 – 297Missing in isoform 2. CuratedAdd BLAST54
Alternative sequenceiVSP_043878252 – 322Missing in isoform 5. 1 PublicationAdd BLAST71
Alternative sequenceiVSP_043879476 – 522AAADE…DRQKT → VNST in isoform 3. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U49184 mRNA Translation: AAC50451.1
U53823 mRNA Translation: AAB00195.1
FJ786083 mRNA Translation: ACT53743.1
FJ786084 mRNA Translation: ACT53744.1
AF400630
, AF400623, AF400624, AF400625, AF400626, AF400627, AF400628, AF400629 Genomic DNA Translation: AAL47094.1
GQ225096 mRNA Translation: ACT83431.1
GQ225097 mRNA Translation: ACT83432.1
GQ225098 mRNA Translation: ACT83433.1
GQ402517 mRNA Translation: ACZ80515.1
AB451306 mRNA Translation: BAG70120.1
AB451437 mRNA Translation: BAG70251.1
AC145146 Genomic DNA No translation available.
AC147575 Genomic DNA No translation available.
BC029886 mRNA Translation: AAH29886.1
BK001650 mRNA Translation: DAA01837.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4006.1 [Q16625-1]
CCDS54864.1 [Q16625-4]

Protein sequence database of the Protein Information Resource

More...
PIRi
G02533

NCBI Reference Sequences

More...
RefSeqi
NP_001192183.1, NM_001205254.1 [Q16625-1]
NP_001192184.1, NM_001205255.1 [Q16625-4]
NP_002529.1, NM_002538.3 [Q16625-1]
XP_016864402.1, XM_017008913.1 [Q16625-2]
XP_016864403.1, XM_017008914.1 [Q16625-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.592605

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000355237; ENSP00000347379; ENSG00000197822 [Q16625-1]
ENST00000396442; ENSP00000379719; ENSG00000197822 [Q16625-1]
ENST00000538151; ENSP00000445940; ENSG00000197822 [Q16625-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
100506658

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:100506658

UCSC genome browser

More...
UCSCi
uc003jwu.3 human [Q16625-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Occludin entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U49184 mRNA Translation: AAC50451.1
U53823 mRNA Translation: AAB00195.1
FJ786083 mRNA Translation: ACT53743.1
FJ786084 mRNA Translation: ACT53744.1
AF400630
, AF400623, AF400624, AF400625, AF400626, AF400627, AF400628, AF400629 Genomic DNA Translation: AAL47094.1
GQ225096 mRNA Translation: ACT83431.1
GQ225097 mRNA Translation: ACT83432.1
GQ225098 mRNA Translation: ACT83433.1
GQ402517 mRNA Translation: ACZ80515.1
AB451306 mRNA Translation: BAG70120.1
AB451437 mRNA Translation: BAG70251.1
AC145146 Genomic DNA No translation available.
AC147575 Genomic DNA No translation available.
BC029886 mRNA Translation: AAH29886.1
BK001650 mRNA Translation: DAA01837.1
CCDSiCCDS4006.1 [Q16625-1]
CCDS54864.1 [Q16625-4]
PIRiG02533
RefSeqiNP_001192183.1, NM_001205254.1 [Q16625-1]
NP_001192184.1, NM_001205255.1 [Q16625-4]
NP_002529.1, NM_002538.3 [Q16625-1]
XP_016864402.1, XM_017008913.1 [Q16625-2]
XP_016864403.1, XM_017008914.1 [Q16625-2]
UniGeneiHs.592605

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WPAX-ray1.50A413-522[»]
1XAWX-ray1.45A383-522[»]
3G7CX-ray2.00A416-522[»]
ProteinModelPortaliQ16625
SMRiQ16625
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111004, 68 interactors
DIPiDIP-42791N
IntActiQ16625, 18 interactors
MINTiQ16625
STRINGi9606.ENSP00000347379

Protein family/group databases

TCDBi9.B.41.1.1 the occludin (occludin) family

PTM databases

iPTMnetiQ16625
PhosphoSitePlusiQ16625

Polymorphism and mutation databases

BioMutaiOCLN
DMDMi3914196

Proteomic databases

EPDiQ16625
jPOSTiQ16625
MaxQBiQ16625
PaxDbiQ16625
PeptideAtlasiQ16625
PRIDEiQ16625
ProteomicsDBi60966
60967 [Q16625-2]
60968 [Q16625-3]
60969 [Q16625-4]
60970 [Q16625-5]
60971 [Q16625-6]
60972 [Q16625-7]
TopDownProteomicsiQ16625-3 [Q16625-3]
Q16625-6 [Q16625-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000355237; ENSP00000347379; ENSG00000197822 [Q16625-1]
ENST00000396442; ENSP00000379719; ENSG00000197822 [Q16625-1]
ENST00000538151; ENSP00000445940; ENSG00000197822 [Q16625-4]
GeneIDi100506658
KEGGihsa:100506658
UCSCiuc003jwu.3 human [Q16625-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
100506658
DisGeNETi100506658
EuPathDBiHostDB:ENSG00000197822.10

GeneCards: human genes, protein and diseases

More...
GeneCardsi
OCLN
HGNCiHGNC:8104 OCLN
HPAiCAB013075
CAB068212
CAB068213
CAB068214
HPA005933
MalaCardsiOCLN
MIMi251290 phenotype
602876 gene
neXtProtiNX_Q16625
OpenTargetsiENSG00000197822
Orphaneti1229 Congenital intrauterine infection-like syndrome
PharmGKBiPA31893

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGK8 Eukaryota
ENOG4110E0E LUCA
GeneTreeiENSGT00730000110989
HOGENOMiHOG000233490
HOVERGENiHBG004523
InParanoidiQ16625
KOiK06088
OMAiYAPSNDM
OrthoDBi710557at2759
PhylomeDBiQ16625
TreeFamiTF326161

Enzyme and pathway databases

ReactomeiR-HSA-351906 Apoptotic cleavage of cell adhesion proteins
R-HSA-8935964 RUNX1 regulates expression of components of tight junctions
SIGNORiQ16625

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
OCLN human
EvolutionaryTraceiQ16625

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Occludin

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
100506658
PMAP-CutDBiQ16625

Protein Ontology

More...
PROi
PR:Q16625

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000197822 Expressed in 197 organ(s), highest expression level in thyroid gland
CleanExiHS_OCLN
GenevisibleiQ16625 HS

Family and domain databases

InterProiView protein in InterPro
IPR031176 ELL/occludin
IPR008253 Marvel
IPR036259 MFS_trans_sf
IPR002958 Occludin
IPR010844 Occludin_ELL
PANTHERiPTHR23288 PTHR23288, 1 hit
PTHR23288:SF4 PTHR23288:SF4, 1 hit
PfamiView protein in Pfam
PF01284 MARVEL, 1 hit
PF07303 Occludin_ELL, 1 hit
PIRSFiPIRSF005993 Occludin, 1 hit
PRINTSiPR01258 OCCLUDIN
SUPFAMiSSF103473 SSF103473, 1 hit
PROSITEiView protein in PROSITE
PS51225 MARVEL, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiOCLN_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q16625
Secondary accession number(s): B5BU70
, D2DU64, D2DU65, D2IGC0, D2IGC1, E2CYV9, Q5U1V4, Q8N6K1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: November 1, 1996
Last modified: January 16, 2019
This is version 172 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again